KEGG   Naegleria gruberi: NAEGRDRAFT_59107Help
Entry
NAEGRDRAFT_59107  CDS       T01241                                 

Definition
ubiquitin specific protease-like protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NAEGRDRAFT_59107
Peptidases [BR:ngr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NAEGRDRAFT_59107
Transcription machinery [BR:ngr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     NAEGRDRAFT_59107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 568 aa AA seqDB search
MNGKNSSSSSSNGSSLSSKTHCKHFQKLLVEQPANPTSAYDEYGELSMDNSLATYLNSSR
TSSTLSQLSRCNCCTNHFSLKDENVMCTACFHIFTLHTFSEGKQERESTSCPQCKNDITF
HLTYKEFFCLECFDFVTLEHDSLKYVLLPSLFSSSIMNNSSDKQSEKKRKISHNTSRETT
EKTNKDFNLESSIKTMLKSSVNTRENSLLGLRGMVNLGNTCFMNCILQTLSHIIPLRNYF
LSGTTVLKIESEIENNPEYSSEYDLKTYLSISKAVRNMYTEMYNPSNSTTAIKSKKRSSN
GKRKSDGDEVIEETVFPFVPDQFLYLIWNAAGNLAGYQQQDAHEFYITLLSFLMPVKLPN
NQSNTIQELFTGQVQSDIICKHCGHVSSTMEPILDVSLALKGKSGKEWIDLESLEECLEK
YTNDESLEINDYSCSSCKTKATITKQLKFSKLPKLVCFHLKRFEHNEGVGRKSASSSKID
EHISFPFTLNMTPYMSRSSQTKDNNSPTTEEYSLFSVVCHTGDMSGGHYTCFVKHDVQWY
LCNDSSVYYAMEEDVADSEAYCLFYMKK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaaagaattcttcttcttcctcttctaatgggtcttctctttcatctaaaacc
cactgtaaacattttcagaaattacttgttgaacaacctgcaaatccaacctcagcctat
gatgagtatggtgaattgagtatggataatagcctggcaacgtatttaaattcttcccgt
actagttcgactttatcacaactttcgagatgcaactgttgcaccaatcacttctcattg
aaggatgagaatgtcatgtgcactgcttgttttcacatattcacacttcacaccttcagt
gaaggcaaacaagaaagagagagcacttcttgccctcaatgtaaaaatgatatcaccttc
cacctcacttataaggagttcttttgtttggagtgttttgattttgtaactctggaacat
gactctttgaaatacgttcttcttccctcactcttttcctcatccatcatgaacaattca
tcggataagcagagtgaaaagaagagaaaaatttcccacaatactagtagggaaactacc
gagaaaacaaataaggattttaatttggaatcatccatcaagacaatgctcaagagttct
gtaaatacacgagaaaactcattattgggccttagaggaatggtaaatttaggaaacact
tgtttcatgaactgtatattacaaacactttcacatattattccattgagaaattacttc
ctctctggaacaacagttttgaaaatagaatcagaaattgagaataatcccgaatacagc
tcagaatatgatctgaaaacctacctgtccataagtaaggctgtcaggaatatgtacact
gaaatgtataacccatccaatagcacgacagctatcaagagcaaaaagagatcgagtaat
ggtaagagaaaatcagatggagatgaagtaatcgaggaaactgtctttccattcgttcca
gatcaatttctctatctcatttggaatgctgcaggaaatttggctggctatcaacaacag
gatgctcacgaattttatatcactctcctctccttcctcatgcctgtaaaattaccaaat
aatcagagtaataccattcaggaattatttactggtcaagttcaatcagatattatttgt
aaacattgtggacatgtttcatcaactatggaaccaatactcgatgtttctcttgctctt
aagggaaagagtggaaaggaatggattgatttagaatcattggaggaatgtttggaaaag
tatacgaatgacgaaagtttggaaattaatgattattcatgttccagttgcaaaaccaaa
gccaccattaccaaacagctcaaattttcaaaattgccaaaacttgtatgtttccatctg
aaacgttttgaacacaatgaaggagttggaagaaaatcagcatccagttccaaaattgat
gaacacatttcattcccattcactttaaatatgacaccttacatgtcaagatcatcacaa
acgaaggacaataactcaccaacaacggaggagtactcactcttttctgtggtttgtcac
actggagatatgagtggaggtcactatacttgtttcgttaagcatgatgttcaatggtat
ttgtgtaatgactcgtccgtttactatgccatggaggaagatgttgccgatagtgaagct
tactgtttgttttacatgaagaaataa

DBGET integrated database retrieval system