KEGG   Naegleria gruberi: NAEGRDRAFT_59636Help
Entry
NAEGRDRAFT_59636  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
ngr  Naegleria gruberi
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NAEGRDRAFT_59636
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NAEGRDRAFT_59636
Enzymes [BR:ngr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     NAEGRDRAFT_59636
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     NAEGRDRAFT_59636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 1818 aa AA seqDB search
MYSPSPSNKSYMVYANNKANTTTNPSSNSTTTTGGAAVTGHSASTTNNPLNSLLSAASLL
LSDDSNSNSLNQTTSPTVSESSSNSTLVTATNTTTTTTTIPNPNNNNNNGKMMNNNQPSP
SDMFDGYLELQDGTRYYGKLFGANKCLIENDSNWNSPFSVSGECVFTTAMVGYPESLTDP
SYHGQILVLTFPLVGNYGAPNFKTTVSNNGNKNLDEFGLLPKLESDKIHIRGLIVQDYSH
NYSHYEAICSLHRWLQEYNIPALYHIDTRAITKKLRDEKSMLARIVTNINYEHELSIKGL
APLQWYDPGQDVEIIKKVTCKDVTIYGKGNKFKVIAIDCGMKYNIIRELVKRDVELKVVP
YNYNWLELDVNNSNNNNTNNDNNTNNNNTNNTNNTNIDGIFISNGPGNPNNFHETISILS
EYISLVQQQQQVPIIPIFGICLGNQLVGKAIGASVYKLPFGNRGHNQPVIDQLTRKCFIT
SQNHGYAIDNQTLPSNFKPYFINANDQSNEGVYCLNLPIFTAQFHPEAKGGPSDTFFLFD
QFIDLIKLKISNKLHRVKNFESKYSKVFIKHHKNMKTKFNQLLKSVEDTSDISTPILKQQ
ESLMKKSIFNQSIIQEEKKLSTLDEKKKVLPKKVIILGSGGLQIGQAGEFDYSGSQAIKA
LKEEGIYTILVNPNIATVQTCKELADRVYFGAVTPDFVEKVIKKENADGLLLSFGGQTAL
NCGVQLHKSGVLEELNCRVLGTPVQSIIDTEDRDIFNQKMREISQPIADSKACDNVEEAI
LAASHIGYPVIIRAAFALGGLGSGFANDERELRELATQALSSSPQILVEKSVKGWKEVEY
EVVRDCNDNCITVCNMENFDPVGIHTGESIVVAPSQTLNNDEYHMLRTAAIKVIRHLGIV
GECNIQYALNPYSKEYVIIEVNARLSRSSALASKATGYPLAFVAAKLSLGMELIDIKNSV
TKETIACFEPALDYCVVKMPRWDLKKFTRVSTVIGSAMKSVGEVMAIGRNFEEAIQKAIR
MVDTSYRGFDSANSSFDLEKLMKQYSSSSNTAANTNTTTASSNHHQHHHQQYQYHHHSGS
SHNSVGSANTNYGSFGSGSTHFGSFGQTHYGSFGSSSHSHLFNSSVTNPFALQPQVSPKE
DIKQKIIRELTHPTDQRIFAISLAMEHFEMTVDQIHQFTQIDRWFLYKLQNIIQTKKALV
GIGKLLNSLPELPYPLLLLSKQQGFSDLQIASSLPSLLYHEFLQAILKNQVQFPYQLSCF
NNNTNTNNNSNNTTTDNTNNTTNNNTNNTQPQYKDTYKNPPKLSKIDKELMVRFIRKYQY
KIEPIVKQIDTLAAEYPAQTNYLYTTYNAGINSIGKEGGEMIYPDHCYHHDVSFNDEGII
VLGSGVYRIGSSVEFDYCGVMSVRELKRLNYKTIMINYNPETVSTDYDEPDRLYFEELSL
ERVLDIYELEHSQGVIVSVGGQQPNNIVLPLDKQCHVKILGTSSDSIDKCEDRSKFSQLL
DSLVNEKTGDKLVYQPEWANLITIEDALIFANKVQYPVLIRPSYVLSGAAMNVAYSDSEL
LQQLYMAADVSKEHPVVISKFYENAKEIEIDGVAMNGEIIIDAISEHVERAGTHSGDATL
ICPPYSLSFDIQDLIREKASMIVKSLSISGPFNMQFLFDNECIHDDDQEEEEEHGQQQGM
TQSFSTNSLDGYDDSFESESLYLKLSKRLRVIECNLRASRSFPFISKTLDLDFIALATRI
FTHHFNLPSSSSSLASSLVNSNTITSLPGSNVPTRNYYQQMNLLEQITMKREQVESITHS
NTSSLQNNSNGKTDDNDR
NT seq 5457 nt NT seq  +upstreamnt  +downstreamnt
atgtactctccatcaccttctaacaaatcctacatggtttatgccaataataaggctaat
accaccaccaatccatcatccaattctacaaccaccacaggaggagcagcagtaacaggt
cattctgcttcaaccaccaataatccattgaatagtttattgagtgctgcttctttatta
ttgtccgatgattcaaattccaactctctgaatcaaacaacctcaccaacagtatctgaa
tcatcatccaattctacacttgttacagctacaaatactactacaaccactactaccatt
cctaatcctaataataataataataatggtaaaatgatgaataataatcaaccatcacca
tctgatatgtttgatggttatttagaattacaagatggtacaagatattatggtaaatta
tttggagctaataagtgtttaattgaaaatgattccaattggaattcaccattttctgtg
agtggtgaatgtgtttttacaactgcaatggttggttatcctgaatcattgactgatcct
tcttatcatggtcaaattttagttttaacttttccacttgttggtaattatggtgcacca
aatttcaaaacaacagtttctaataatggtaataagaatttagatgaatttggattgctt
ccaaaattagaaagtgataagattcatattagaggtttaatagttcaagattattcacat
aattattcacattatgaagcaatttgttcacttcatcgttggttacaagaatataatatt
ccagctctatatcacattgatacgagagcaattacaaagaaattgagagatgaaaaatca
atgttagcaagaattgttacaaatattaattatgaacatgaactttctattaaaggtctt
gctcctttacaatggtatgatccaggtcaagatgttgaaattattaagaaagtaacttgt
aaagatgttactatttatggtaaaggtaataagtttaaagttattgctattgattgtggt
atgaaatataatattattcgtgaacttgttaaaagagatgttgaattgaaagttgttcca
tataattataattggttagaattagatgttaataattcaaacaataataataccaacaat
gataataatactaataataataatactaataatactaataatactaatattgatggtatt
tttattagtaatggacctggtaatccaaataatttccatgaaactatttcaattttatct
gaatatatttcattagttcaacaacaacaacaagttccaattattcctatttttggtatt
tgtttaggtaatcaattggttggtaaagctattggtgcaagtgtttataaattaccattt
ggtaatagaggtcataatcaacctgttattgatcaattaacacgtaaatgttttatcact
tcacaaaatcatggttatgctattgataatcaaactttaccttcaaatttcaaaccatat
ttcattaatgccaatgatcaatctaatgaaggtgtttattgtttgaatttaccaattttt
acagctcaatttcatccagaagctaaaggtggaccaagtgatactttctttttatttgat
caatttattgatttgatcaaattaaagatttcaaacaagttacatcgtgttaaaaatttt
gaatctaaatatagcaaagtatttatcaaacatcataagaatatgaaaactaaattcaat
caattattgaaatctgttgaagatacttcagatatttcaactccaattttaaaacaacaa
gaatctttaatgaagaagagtatttttaatcaatcaattattcaagaagaaaagaaactc
tcaactcttgatgaaaagaagaaggtattaccaaagaaggttattattttaggttcaggt
ggtttacaaattggtcaagcaggtgaatttgattattcaggatcacaagctattaaagca
cttaaagaagaaggaatttatacaattttagttaatccaaatattgctacagttcaaaca
tgtaaagaattggctgatagagtttatttcggggcagttacacctgattttgttgaaaaa
gtcattaagaaggagaatgcagatggtttacttttatcatttggtggtcaaactgcatta
aattgtggtgttcaattacacaaatcaggagttttagaagaattgaattgtagagtatta
ggtacacctgttcaatcaattattgatactgaagatcgtgatattttcaatcaaaagatg
cgtgaaatttcacaaccaattgctgattcaaaggcatgtgataatgttgaagaggcaatt
ttagcagcctctcacattggttatccagtaattattagagcagcatttgcattgggtgga
ttaggaagtggatttgccaatgatgaacgtgaattgagagaattggcaactcaagcactt
tcaagttcacctcaaattcttgttgaaaaatcagttaagggatggaaagaagttgaatat
gaagttgttcgtgattgtaatgataattgtattacagtttgtaatatggaaaactttgat
ccagttggtattcatacaggtgaatcaattgttgttgcaccatcacaaacattaaataat
gatgaatatcacatgttgagaactgctgctattaaggttattagacatttgggtattgtt
ggtgaatgtaatattcaatatgcattgaatccatacagtaaggaatatgttatcattgaa
gttaatgctcgtttatcaagaagttcagctttggcttcaaaagcaactggttatccactt
gcatttgttgctgctaaactttcattgggaatggaattgattgatattaagaattctgtt
actaaggaaactattgcttgttttgaacctgcattagattattgtgttgttaaaatgcca
cgttgggatttgaagaaattcactcgtgtttcaactgtcattggatcagcaatgaaaagt
gttggtgaagtgatggccattggtagaaattttgaagaagcaattcaaaaagctattaga
atggttgatacttcatatagaggatttgattctgccaattcttcatttgatttggaaaag
ttgatgaaacaatattcttcttcttctaatactgctgctaatactaatactactactgct
tcttcaaatcatcaccaacatcaccatcaacagtatcaatatcaccatcactctggttca
tctcataatagtgttggttctgctaatactaattatggtagttttggatctggttctact
cattttggaagctttggtcaaactcattatggtagttttggatctagttctcattctcac
ttatttaatagtagtgtcactaatccatttgctttacaaccacaagtttcaccaaaagaa
gatatcaaacaaaagattattagagaattaactcatccaactgatcaacgtatctttgct
atttcacttgctatggaacattttgaaatgacagttgaccaaattcatcaatttactcaa
attgatcgttggttcttgtacaaattacaaaatattattcaaactaagaaggcattggtt
ggaattggtaaattattgaattcattacctgaacttccatatccattacttttactttcc
aaacaacaaggtttctctgatttacaaattgcttcaagtttaccttcattgttatatcat
gaatttttacaagcaattttaaagaatcaagttcaattcccatatcaattatcatgtttc
aataataatactaatactaataataatagtaataatactactactgataatactaataat
actactaataataatactaataatactcaaccacaatataaagatacctataaaaatcca
cctaaattaagtaagattgataaagaattaatggttagatttattagaaagtatcaatat
aagattgaaccaattgttaaacaaattgatacattagcagcagaatatccagcacaaaca
aattatctctatacaacctataatgcaggtattaatagtattggaaaggaaggaggtgaa
atgatttatccagatcattgttatcatcatgatgtttcatttaatgatgaaggtataatt
gtattaggaagtggtgtttatagaattggtagtagtgttgaatttgattattgtggtgtg
atgagtgttagagaattgaagagattaaattacaagactataatgattaattataatcct
gaaactgtttcaactgattatgatgaacctgatcgtttatattttgaagaattaagttta
gaaagagttttagatatttatgaattggaacattcacaaggtgttattgttagtgttggt
ggtcaacaacctaataatattgttttacctttggataaacaatgtcatgttaaaatttta
ggaactagttcagattcaattgataaatgtgaagatcgttctaaattttcacaactctta
gattcacttgttaatgaaaagacaggtgacaaattggtttatcaacctgaatgggctaat
ttaattactattgaagatgctttaatttttgctaataaggttcaatatcctgttttaatt
agaccttcatatgttttatcaggtgctgcaatgaatgttgcttattcagattctgaatta
ttacaacaattatatatggctgctgacgtttctaaagaacatccagttgtcatttctaaa
ttttatgaaaatgctaaagaaattgaaattgatggtgttgcaatgaatggtgaaattatt
attgatgcaattagtgaacatgttgaaagagcaggtactcactctggtgatgctactcta
atttgtccaccttattcattgagttttgatattcaagatttaattagagaaaaggcatca
atgattgttaaatctttatcaattagtggtccatttaatatgcaattcttatttgataat
gaatgtattcatgatgatgatcaagaagaagaagaagaacatggacaacaacaaggaatg
actcaatcattctcaacaaattcactagatggatatgatgatagttttgaatctgaatct
ttatatttgaaattatcaaagagattacgtgttattgaatgtaatttgagagcaagtaga
tcattcccattcattagtaagactttagatttggattttattgcattggctactagaatc
tttactcatcatttcaatttaccatcttcttcttcatcattagcatcatcattggtcaat
tcaaataccatcacaagcttaccaggtagtaatgttccaactagaaattattatcaacaa
atgaatttacttgaacaaattacaatgaaacgtgaacaagttgaatccattacacattct
aatacatcatcattacaaaataatagtaatggtaaaactgatgataatgatagatag

DBGET integrated database retrieval system