KEGG   Naegleria gruberi: NAEGRDRAFT_59754Help
Entry
NAEGRDRAFT_59754  CDS       T01241                                 

Definition
phosphatidylcholine-sterol acyltransferase
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
ngr  Naegleria gruberi
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NAEGRDRAFT_59754
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NAEGRDRAFT_59754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 489 aa AA seqDB search
MTTSLPKSHHLLLLALIIIILVSVISTNCELSSQQPTIKIKDEKLRKLLNRDRIEIGQLF
NMYQGRKDIKFVNSNNKKATDAKFSPLIAVGGLGGSALMSKRDHAVNEPHWWCEKTTRDP
FQIWMSLEELVPFFTEDCFVHDMSIELKDGLLRQKDSGVRIFGKDIGGMGGLESVFAQLE
SKAYYMKYLSDYLVKYGNFQIGKSLRGLTIDWRLGVKEWSNNNNTIGGDFYTLKSLVEDT
YYKNGNLKVSLLGHSMGGPFLQYFLANFVNQVWKDQYISNFIPLSGAFDGSPIALILYMT
GTNWGLPIFELENARKILHQYPSPLYMSPNYSPFQYPFFTYNNTKVVKNYESSSLADIEK
FMTDAKIKNGFELYQHEYSAYKYNKIAAPNVTTHCLYGYGIPTITHVEYSGPKEMSELNF
NDLVHGMNILKVEDGDGVVPSYSLQICDEFAKYQKQPVYIHRFFNASHTGIIYEEKTFET
LLEILKVNN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctctcttcccaaaagccatcatttattgctccttgcactcatcatcatcatc
ttggtgtctgttatatcaacaaattgtgaattatcctcccaacaaccaaccatcaaaatt
aaagatgaaaaattgagaaagttattgaacagagatcggattgaaattggccaattattc
aacatgtatcaaggaagaaaggatatcaaatttgttaatagtaataataagaaggcaact
gatgccaagttttcaccattgattgctgtaggagggttgggtggatctgcactcatgtcc
aagagagatcatgctgtgaatgaacctcattggtggtgtgaaaagacaaccagagatcca
tttcaaatttggatgtctttggaagagttagttccattctttactgaggattgtttcgtt
catgacatgtctattgagttgaaagatggattgttgagacagaaagatagtggagtgaga
atttttggaaaggacattggtggaatgggtggtttggaatcagtttttgctcaattggaa
agtaaggcctactatatgaaatatttatctgattatttggtcaagtatggaaattttcaa
attggaaagagtttgagaggtctcacaattgattggagattgggtgttaaagaatggtcc
aataataataacacaattggaggtgatttttacacattgaaatcattggttgaggatacc
tattacaagaatggaaatttgaaagtttcccttcttgggcatagtatgggaggtcctttc
ttacaatattttttggcaaactttgtcaaccaagtgtggaaagatcaatatatttcaaat
ttcattccactatctggtgcttttgatggtagtccaattgcattgatattgtacatgaca
ggaaccaattggggacttccaatattcgaattggaaaatgccagaaagattcttcaccaa
tatccatcaccattgtacatgtctccaaattattcaccattccagtatccatttttcaca
tataacaatactaaagtggtcaagaattatgaatcttcttcattggcagacattgaaaaa
ttcatgacagatgccaaaattaagaatggtttcgaattgtatcaacatgaatactctgct
tataagtataataagattgctgctccaaatgtcaccactcattgtttgtatggatatggc
atcccaactatcactcacgttgaatattcaggtccaaaggaaatgagtgaattgaatttc
aatgacctagttcatggaatgaatattttgaaagtggaagatggagatggagttgttcca
tcctattctcttcaaatttgtgatgaatttgctaaatatcagaaacaaccagtttatatt
catcgtttcttcaatgcaagtcatactggaattatttatgaagaaaaaacatttgaaact
ttattggaaatattgaaagttaataattaa

DBGET integrated database retrieval system