KEGG   Naegleria gruberi: NAEGRDRAFT_59984Help
Entry
NAEGRDRAFT_59984  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ngr  Naegleria gruberi
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NAEGRDRAFT_59984
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NAEGRDRAFT_59984
   00640 Propanoate metabolism
    NAEGRDRAFT_59984
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NAEGRDRAFT_59984
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    NAEGRDRAFT_59984
Enzymes [BR:ngr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     NAEGRDRAFT_59984
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NAEGRDRAFT_59984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 2218 aa AA seqDB search
METDSPVIPTQSNHGIFASVEEYVSFMGGNKIIKKILIANNGIAAVKGIRSMRKWCNEVF
GKSDEIKFVVMATPEDIQANAEYVRLADELVKVPGESNYNNYSNVKLIVDIAEQFCCDAV
WPGWGHASENPELPFSLSQTKRQIAFIGPDSVPMEALGDKISSTILAQAAGVPCIPWSGS
EVHYDITKSGLPIPEDIYLKCCITSESEALKCANKIGYPIMIKASEGGGGKGIRKVANDI
ELKLGFSQVKNEVPGSPIFLMKLSSESRHLEVQVVADKHGNALALYSRDCSVQRRHQKII
EEGPVTVAPKHVIDKMEAAAVTLARSVNYSGAGTVEYLYEPATEHVYFLELNPRLQVEHP
VTEWITLTNIPSIQLQIAMGISLNRIPDIRRFFGVQLKDLYTVEPQIDVNDAARRQPPVG
HVIACRVTAENPESGFQPTCGSVVELNFRTNPNVWGYFSIRSQGAIHAFSDSQFGHIFTK
GETREEARKTMLSTLSELAIRGEIRTTAEYLQSLLKFDDYVNNNYTTSWLDNLISKKIKL
EKPDTLLVVTCGAVHTLHRMVSERAKNWILAVERGQVPSFDNVDVHYSIELIYENIKYQV
DGVRSGPNKYTLALNGSTIEAELSELRDSGLLIVVDNGSHVSYASEEPSGLKLTLDGKVC
MFTKEFDPSQLRSTLSGKFMKYLVENGAHVKPNTPVAELEVMKMIVTVYAPLPGRVNHCL
VDGTGVNQGDIIAIIDLDDKSQVKRSLPFEGQFPPAAKVNARLPPNRVVSSALETVQNLL
AGYDYPAFIFNDKLSETMLSLRKLGDRNVIIHEMIEKLSVLRKFLPVSLVREVNNLLQKR
KIEYDEYCCKDDNDHTQDVYNEDLVKEITSIFKNFESGLEGAKKEEFLIAAKPVFELLEL
FNNGYKQHAFSTLAKLLEEYIQTEKIFDTTGGKRREAVWFELRQKHSENLNKTYQIGLSH
FRLSSKNKVIRSLLEIIEELDMVKESTPLLDELASFVAPEFSDVAVAAKHILTSSRLPSK
QRMKDEMEGYFKDGLEAVDNQQKLACLKELIVKSNYSFDILLEFFSDPDERIANLAAEVY
IRKAYCTFDIDISRVTSQPKFKTVEFSFMNTEKSTSGSLKSDGIVGSISMDCLSSLSETE
DNIGFGVLAIFDSVSDIDAHLPDVMKIFENNDDADNTNVLKILLRAHGPTPNDVELLPSL
TNLLKKHSESLQYNEIKRVTVVVEVQDKLPFYFTFRQRFNYDEDPMYRHIEPTLAFQLFL
KKLSNYNITPYPCKDPSVHVFYGQKKKELGLNRYDFLNKRFFVRTLVLQGDIFTEENPEE
LQISELERYVVASINALEIAMADKNYPTSYANHIFVNFLPEVVVKADMVGEIIERFQKVY
GKRLWKLRVSEVEVRFTAKFSRTSQPQTFRFIALDDTGYNLTLDVYREEKDQTTGRTVYK
TVVGEKKPLEGLDVNIPHPILQAVDQKRVLAHNNDTSYVYDFPYLFERVVRSMWKEHNDL
TKEDIPSTFISLTEYILDTTGKFLIENPVKNAIGKNTCGMVVWKVTLFTPEAKDGRDMIL
IANDITYQSGSFGVIEDEVFQLASEMARKLKIPRFYIAANSGARIGLADEVRELFKIEWN
EPNDSTKGFKYLYLTPNDYEKLQKTNSVNAVEIEVNGEKRWKIIDIIGKENGIGVENLRG
SGMIAGETSRAYEEVFTMNYIAARSVGIGAYVNRLGQRIIQNRKAPILLTGAGALNKVLS
REVYTSNLQLGGIQIMNPNGVTHLIAKDDYLAIKDALKWLSYVPKSVGSALPILKTLDDP
ERQIQYLPVEGSHYDFREMLVGKTVEGENGESTWLSGFFDKNSFFETLTGWAKNIIVARA
RLGGIPMGVIAVDTKTYEQIIPADPADSNSRERVVQKSGQVWYPDSAFKTAQAINDFNKG
EQLPLMIFANWRGFSGGQRDMFDEILKFGSYIVDALTNYKQPVFVYIPPNGELRGGAWVV
VDPMINNDVMEMFADDKSKGGILEASGIVEIKYRKQEIVATIQRLDAEYINLAKELGRSD
ISLKEKDEIKVKMGKRVEKLIPIYTQVAECFADLHDTPGRMKAKGVITEIISWKTARTYF
YWRLKRKILEFNLLKELSECVDAQSNKLSIKREILRQKVINNEQVWTNDREFLSWIEDNK
ETVTQAIATLRGEKVKQDILSLCSSGNLGSVCDGLLSFLENNSDAVGESLKEKLRKLL
NT seq 6657 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagatagtccagttattcctacacaatctaatcatggcattttcgcaagtgta
gaagaatatgttagttttatgggtggcaacaagataatcaaaaagatactgatagcaaac
aatggtattgccgcagttaaaggaattcgttcaatgagaaaatggtgtaatgaagttttt
ggtaaatcagatgaaattaaattcgtagtaatggctacacctgaagatatccaagccaat
gccgaatatgttagattggctgatgaattagtcaaagtaccaggtgaatcgaattataac
aattacagcaatgttaaattaatagtagatattgctgaacaattttgttgtgatgcagtt
tggccaggttggggacacgctagtgaaaatccagaacttccattttcactttcacaaact
aaacgacaaattgcttttattggtccagacagtgtaccaatggaagctttgggagacaag
atttcttccacaattttggctcaagcagctggtgttccttgtattccatggtctggttcc
gaggttcactacgatattacaaagagtggtttaccaattcctgaagacatttatttaaag
tgttgtatcacttctgaatcagaagctttgaaatgtgcaaataagattggatatccaata
atgattaaagcttctgaaggtggtggtggtaaaggtattcgtaaagtagcaaatgatatt
gaattgaaattgggattttcacaagttaaaaatgaagtgccgggatctcctattttcttg
atgaaactctctagtgaaagtagacacttggaagttcaagttgttgctgataaacatggt
aatgctctcgcattatattcaagagattgttccgttcaaagaagacatcaaaagattatt
gaagaaggtccagttacagttgctccaaagcacgttattgataaaatggaagctgcagct
gtcacacttgctcgtagtgttaattatagtggtgctggtacagttgaatatctttatgaa
cctgctactgaacatgtttactttttggaattgaatcctagattgcaagttgaacatcca
gtcacagaatggattacactcaccaatattccatctatccaacttcaaattgctatggga
atatcattaaatcgtattccagatattagaagattctttggtgttcaattgaaggatctc
tacactgttgaaccacaaattgatgttaacgatgctgctaggagacaacctccagttggt
cacgttattgcttgccgtgttacagctgaaaatccagaaagtgggttccaaccaacttgt
ggttctgttgttgaacttaactttagaacaaatccaaacgtttggggatatttctcaatt
cgttcccaaggtgccatccacgctttctctgattctcaattcggtcacattttcacaaag
ggtgaaacaagagaagaagcaagaaagactatgctttcaacactttctgaattagccatc
agaggcgaaatcagaacaacagctgaatatttacaatcacttttgaagtttgatgattat
gttaataacaattatacaacatcatggttggataatcttatttcaaagaaaattaaattg
gaaaagcctgatacacttttagtagttacttgtggtgcagtccatactctccacagaatg
gtttccgagagagccaagaattggattttggctgttgaaagaggacaggttccttcattt
gacaatgttgatgtacactactctattgaacttatttatgaaaatattaaatatcaagtt
gacggagttagaagtggaccaaacaaatatactttggctttgaatggatctacaatagaa
gctgaattgtctgaattgagagattctggattactcattgttgttgacaatggatcacac
gtctcttatgccagtgaagaaccttcgggcctcaaacttacacttgacggtaaggtttgt
atgtttactaaggaattcgatccatctcaattgagatcaacattgagtggtaaattcatg
aagtatttggttgaaaatggtgctcatgttaaaccaaatactccagttgctgaattggaa
gtcatgaagatgattgtcactgtttatgctccacttccaggtagagttaatcactgtctt
gttgatggtactggtgttaaccaaggagatatcattgctataatcgatcttgatgataaa
tcccaagttaagagatcacttccattcgaaggccaattccctcctgctgctaaggttaat
gcaagacttcctccaaatagagttgtttcttctgctttggaaactgttcaaaacttgttg
gctggttatgattatcctgctttcattttcaatgacaaactctcagaaaccatgttgtca
ctcagaaaactcggtgatagaaatgttattatccatgaaatgattgaaaagctttcagtt
ttgagaaaattcttaccagtatcattggttagagaagtcaataaccttttgcaaaagaga
aagattgaatacgacgaatattgttgcaaggatgataatgatcacacccaagatgtttac
aatgaggatttagttaaggaaattacttctattttcaagaactttgaaagtggtcttgaa
ggagctaagaaggaagaattcctcatcgctgccaaaccagtttttgaacttttggaactc
ttcaataatggatacaagcaacatgctttctccactctcgccaaattacttgaagaatat
attcaaactgaaaagatctttgataccactggtggtaagagaagagaagctgtttggttt
gaattgagacaaaaacactctgaaaacctcaacaagacttaccaaattggtctctcccac
tttagacttagcagtaagaataaggttattcgttctcttttagaaattattgaagaactc
gacatggttaaggaatcaactccacttttggatgaattggcttcatttgttgctccagaa
ttcagtgatgttgctgttgctgctaaacacatcctcacctcaagtagattgccttctaag
caaagaatgaaggatgaaatggaaggatactttaaggatggacttgaagctgttgataat
caacaaaagcttgcttgtttgaaggaattaattgtcaagtctaactatagtttcgacatt
cttcttgaattcttctctgatccagatgaaagaattgctaacttggctgctgaagtctac
atcagaaaggcatactgtacttttgatattgatatttcaagagttacctcccaaccaaag
ttcaagactgttgaatttagttttatgaatactgaaaagtccacttcaggttcattaaag
tctgatggtattgttggttctatttctatggactgtttgagcagtctctcagagactgaa
gataacattggttttggtgttttggctatctttgattctgtcagtgatattgatgctcac
cttccagatgttatgaagatctttgaaaataacgacgatgctgacaatactaatgttttg
aagattttgttgagagctcacggaccaacaccaaatgatgttgaacttctcccatccctt
actaaccttttgaagaagcacagcgaatctctccaatataacgaaattaagagagttact
gttgtcgttgaagttcaagataaattgccattctactttactttcagacaaagattcaac
tatgacgaagatccaatgtacagacatattgaacctacacttgccttccaacttttcctt
aagaaattatctaattataacattactccatacccatgtaaggatccatctgttcacgtt
ttctatggtcaaaagaagaaggagcttggtttgaatagatatgatttcttgaataagaga
ttcttcgttcgtactttggtattgcaaggtgatatcttcactgaagaaaatcctgaagaa
ttgcaaatttcagaacttgaaagatatgttgttgcctcaatcaatgctttggaaattgct
atggctgataagaattacccaactagttatgctaatcacattttcgtcaatttcttacct
gaagttgttgtcaaggcagatatggtaggtgaaattattgaaagattccaaaaggtttat
ggtaagagattgtggaagttgagagttagtgaagttgaagttagattcactgctaaattc
tcccgaacctctcaaccacaaacctttagattcattgctcttgatgacactggttacaat
cttacattggacgtttacagagaagaaaaggatcaaactactggtagaaccgtttacaag
actgttgttggtgaaaagaagccattggaaggtttggatgttaatattcctcaccctatt
ctccaagctgttgatcaaaagagagttcttgctcacaacaatgatacatcctatgtctat
gatttcccatacttgttcgaaagagttgttcgttccatgtggaaagaacataacgatttg
actaaggaagacattccaagcactttcatcagtcttactgaatatattctcgatacaact
ggcaaattcttgattgaaaatccagtcaagaatgctataggtaagaatacatgtggtatg
gttgtttggaaggttactttgttcactccagaagctaaggatggcagagatatgatttta
attgccaacgatatcacatatcaatctggttcttttggtgttattgaagatgaagtattc
caattggctagtgaaatggctagaaagttgaagattccaagattctacattgctgccaac
tctggtgctagaattggtttggctgatgaagtcagagaattattcaagattgaatggaac
gaaccaaatgatagcactaagggcttcaaatatctttacctcactccaaatgattacgaa
aaacttcaaaagaccaactctgtcaatgctgttgaaattgaagttaacggagaaaagaga
tggaagattattgacattattggtaaggaaaatggtattggtgtcgaaaatttgagagga
tctggtatgattgctggtgaaacttctcgtgcctatgaagaagttttcactatgaattat
attgctgcaagaagtgttggtattggtgcctatgttaatcgtcttggtcaaagaattatt
caaaatagaaaagctcctatcttgctcactggtgctggtgctttgaataaggttttgtct
agagaagtttataccagtaatttgcaattgggtggtattcaaatcatgaatcctaatggt
gtcactcacttgattgctaaggatgactatcttgctatcaaggatgctctcaagtggttg
tcatatgttccaaagtcagttggttctgcacttccaatcttgaagactcttgatgatcct
gaacgtcaaattcaatacctcccagttgaaggtagccactatgactttagagaaatgttg
gttggtaagactgttgaaggtgaaaatggagaatcaacatggttgagtggtttctttgat
aagaactcattctttgaaactttgactggttgggcaaagaatattattgttgctcgtgct
agacttggtggtattccaatgggtgttattgctgttgacacaaagacctatgaacaaatt
attcctgctgatcctgctgatagtaactctagagaaagagtagttcaaaaatctggccaa
gtctggtatccagattctgcattcaagactgctcaagcaatcaatgatttcaacaaggga
gaacaattgccactcatgatctttgctaactggagaggtttctctggtggtcaaagagat
atgtttgatgaaatcctcaagtttggttcttacattgttgatgctttgaccaattacaag
caaccagtttttgtttacattccaccaaatggtgaattgagaggtggtgcttgggttgtt
gttgatccaatgatcaataatgatgttatggaaatgtttgctgatgataagtccaagggt
ggtattttggaagcttctggtattgttgaaattaagtacagaaagcaagaaattgttgct
actattcaacgtttggatgctgaatatattaaccttgccaaggaattgggaagatcagac
atttctttgaaggaaaaggatgaaatcaaggtcaagatgggtaagagagttgaaaagttg
attccaatttatactcaagtagctgaatgttttgctgatctccatgatactccaggtaga
atgaaggctaagggtgttattaccgaaatcatttcttggaagactgctagaacttacttc
tactggagattgaagagaaagattctcgaattcaatttgttgaaggaattaagtgaatgt
gtagatgctcaatcaaacaagttatctatcaagagagaaatcctcagacaaaaggtcatc
aataatgaacaagtttggactaacgatagagaattcttgtcttggattgaagataataag
gaaactgttacacaagccattgctacattgagaggtgaaaaggtcaagcaagatattctt
tcattatgttcttcaggtaatttaggttcagtttgtgatggtttgctttccttcttggaa
aataacagtgatgctgttggtgaatctcttaaggaaaagctgagaaaattgctctaa

DBGET integrated database retrieval system