KEGG   Naegleria gruberi: NAEGRDRAFT_59984Help
Entry
NAEGRDRAFT_59984  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
ngr  Naegleria gruberi
Pathway
ngr00061  Fatty acid biosynthesis
ngr00620  Pyruvate metabolism
ngr00640  Propanoate metabolism
ngr01100  Metabolic pathways
ngr01110  Biosynthesis of secondary metabolites
ngr01130  Biosynthesis of antibiotics
ngr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NAEGRDRAFT_59984
   00640 Propanoate metabolism
    NAEGRDRAFT_59984
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NAEGRDRAFT_59984
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    NAEGRDRAFT_59984
Enzymes [BR:ngr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     NAEGRDRAFT_59984
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     NAEGRDRAFT_59984
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NAEGRDRAFT_59984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp_3 ATP-grasp Biotin_lipoyl_2 Dala_Dala_lig_C GCV_H
Motif
Other DBs
NCBI-GeneID: 8862731
NCBI-ProteinID: XP_002669281
JGI: Naegr1_59984
AA seq 2218 aa AA seqDB search
METDSPVIPTQSNHGIFASVEEYVSFMGGNKIIKKILIANNGIAAVKGIRSMRKWCNEVF
GKSDEIKFVVMATPEDIQANAEYVRLADELVKVPGESNYNNYSNVKLIVDIAEQFCCDAV
WPGWGHASENPELPFSLSQTKRQIAFIGPDSVPMEALGDKISSTILAQAAGVPCIPWSGS
EVHYDITKSGLPIPEDIYLKCCITSESEALKCANKIGYPIMIKASEGGGGKGIRKVANDI
ELKLGFSQVKNEVPGSPIFLMKLSSESRHLEVQVVADKHGNALALYSRDCSVQRRHQKII
EEGPVTVAPKHVIDKMEAAAVTLARSVNYSGAGTVEYLYEPATEHVYFLELNPRLQVEHP
VTEWITLTNIPSIQLQIAMGISLNRIPDIRRFFGVQLKDLYTVEPQIDVNDAARRQPPVG
HVIACRVTAENPESGFQPTCGSVVELNFRTNPNVWGYFSIRSQGAIHAFSDSQFGHIFTK
GETREEARKTMLSTLSELAIRGEIRTTAEYLQSLLKFDDYVNNNYTTSWLDNLISKKIKL
EKPDTLLVVTCGAVHTLHRMVSERAKNWILAVERGQVPSFDNVDVHYSIELIYENIKYQV
DGVRSGPNKYTLALNGSTIEAELSELRDSGLLIVVDNGSHVSYASEEPSGLKLTLDGKVC
MFTKEFDPSQLRSTLSGKFMKYLVENGAHVKPNTPVAELEVMKMIVTVYAPLPGRVNHCL
VDGTGVNQGDIIAIIDLDDKSQVKRSLPFEGQFPPAAKVNARLPPNRVVSSALETVQNLL
AGYDYPAFIFNDKLSETMLSLRKLGDRNVIIHEMIEKLSVLRKFLPVSLVREVNNLLQKR
KIEYDEYCCKDDNDHTQDVYNEDLVKEITSIFKNFESGLEGAKKEEFLIAAKPVFELLEL
FNNGYKQHAFSTLAKLLEEYIQTEKIFDTTGGKRREAVWFELRQKHSENLNKTYQIGLSH
FRLSSKNKVIRSLLEIIEELDMVKESTPLLDELASFVAPEFSDVAVAAKHILTSSRLPSK
QRMKDEMEGYFKDGLEAVDNQQKLACLKELIVKSNYSFDILLEFFSDPDERIANLAAEVY
IRKAYCTFDIDISRVTSQPKFKTVEFSFMNTEKSTSGSLKSDGIVGSISMDCLSSLSETE
DNIGFGVLAIFDSVSDIDAHLPDVMKIFENNDDADNTNVLKILLRAHGPTPNDVELLPSL
TNLLKKHSESLQYNEIKRVTVVVEVQDKLPFYFTFRQRFNYDEDPMYRHIEPTLAFQLFL
KKLSNYNITPYPCKDPSVHVFYGQKKKELGLNRYDFLNKRFFVRTLVLQGDIFTEENPEE
LQISELERYVVASINALEIAMADKNYPTSYANHIFVNFLPEVVVKADMVGEIIERFQKVY
GKRLWKLRVSEVEVRFTAKFSRTSQPQTFRFIALDDTGYNLTLDVYREEKDQTTGRTVYK
TVVGEKKPLEGLDVNIPHPILQAVDQKRVLAHNNDTSYVYDFPYLFERVVRSMWKEHNDL
TKEDIPSTFISLTEYILDTTGKFLIENPVKNAIGKNTCGMVVWKVTLFTPEAKDGRDMIL
IANDITYQSGSFGVIEDEVFQLASEMARKLKIPRFYIAANSGARIGLADEVRELFKIEWN
EPNDSTKGFKYLYLTPNDYEKLQKTNSVNAVEIEVNGEKRWKIIDIIGKENGIGVENLRG
SGMIAGETSRAYEEVFTMNYIAARSVGIGAYVNRLGQRIIQNRKAPILLTGAGALNKVLS
REVYTSNLQLGGIQIMNPNGVTHLIAKDDYLAIKDALKWLSYVPKSVGSALPILKTLDDP
ERQIQYLPVEGSHYDFREMLVGKTVEGENGESTWLSGFFDKNSFFETLTGWAKNIIVARA
RLGGIPMGVIAVDTKTYEQIIPADPADSNSRERVVQKSGQVWYPDSAFKTAQAINDFNKG
EQLPLMIFANWRGFSGGQRDMFDEILKFGSYIVDALTNYKQPVFVYIPPNGELRGGAWVV
VDPMINNDVMEMFADDKSKGGILEASGIVEIKYRKQEIVATIQRLDAEYINLAKELGRSD
ISLKEKDEIKVKMGKRVEKLIPIYTQVAECFADLHDTPGRMKAKGVITEIISWKTARTYF
YWRLKRKILEFNLLKELSECVDAQSNKLSIKREILRQKVINNEQVWTNDREFLSWIEDNK
ETVTQAIATLRGEKVKQDILSLCSSGNLGSVCDGLLSFLENNSDAVGESLKEKLRKLL
NT seq 6657 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagatagtccagttattcctacacaatctaatcatggcattttcgcaagtgta
gaagaatatgttagttttatgggtggcaacaagataatcaaaaagatactgatagcaaac
aatggtattgccgcagttaaaggaattcgttcaatgagaaaatggtgtaatgaagttttt
ggtaaatcagatgaaattaaattcgtagtaatggctacacctgaagatatccaagccaat
gccgaatatgttagattggctgatgaattagtcaaagtaccaggtgaatcgaattataac
aattacagcaatgttaaattaatagtagatattgctgaacaattttgttgtgatgcagtt
tggccaggttggggacacgctagtgaaaatccagaacttccattttcactttcacaaact
aaacgacaaattgcttttattggtccagacagtgtaccaatggaagctttgggagacaag
atttcttccacaattttggctcaagcagctggtgttccttgtattccatggtctggttcc
gaggttcactacgatattacaaagagtggtttaccaattcctgaagacatttatttaaag
tgttgtatcacttctgaatcagaagctttgaaatgtgcaaataagattggatatccaata
atgattaaagcttctgaaggtggtggtggtaaaggtattcgtaaagtagcaaatgatatt
gaattgaaattgggattttcacaagttaaaaatgaagtgccgggatctcctattttcttg
atgaaactctctagtgaaagtagacacttggaagttcaagttgttgctgataaacatggt
aatgctctcgcattatattcaagagattgttccgttcaaagaagacatcaaaagattatt
gaagaaggtccagttacagttgctccaaagcacgttattgataaaatggaagctgcagct
gtcacacttgctcgtagtgttaattatagtggtgctggtacagttgaatatctttatgaa
cctgctactgaacatgtttactttttggaattgaatcctagattgcaagttgaacatcca
gtcacagaatggattacactcaccaatattccatctatccaacttcaaattgctatggga
atatcattaaatcgtattccagatattagaagattctttggtgttcaattgaaggatctc
tacactgttgaaccacaaattgatgttaacgatgctgctaggagacaacctccagttggt
cacgttattgcttgccgtgttacagctgaaaatccagaaagtgggttccaaccaacttgt
ggttctgttgttgaacttaactttagaacaaatccaaacgtttggggatatttctcaatt
cgttcccaaggtgccatccacgctttctctgattctcaattcggtcacattttcacaaag
ggtgaaacaagagaagaagcaagaaagactatgctttcaacactttctgaattagccatc
agaggcgaaatcagaacaacagctgaatatttacaatcacttttgaagtttgatgattat
gttaataacaattatacaacatcatggttggataatcttatttcaaagaaaattaaattg
gaaaagcctgatacacttttagtagttacttgtggtgcagtccatactctccacagaatg
gtttccgagagagccaagaattggattttggctgttgaaagaggacaggttccttcattt
gacaatgttgatgtacactactctattgaacttatttatgaaaatattaaatatcaagtt
gacggagttagaagtggaccaaacaaatatactttggctttgaatggatctacaatagaa
gctgaattgtctgaattgagagattctggattactcattgttgttgacaatggatcacac
gtctcttatgccagtgaagaaccttcgggcctcaaacttacacttgacggtaaggtttgt
atgtttactaaggaattcgatccatctcaattgagatcaacattgagtggtaaattcatg
aagtatttggttgaaaatggtgctcatgttaaaccaaatactccagttgctgaattggaa
gtcatgaagatgattgtcactgtttatgctccacttccaggtagagttaatcactgtctt
gttgatggtactggtgttaaccaaggagatatcattgctataatcgatcttgatgataaa
tcccaagttaagagatcacttccattcgaaggccaattccctcctgctgctaaggttaat
gcaagacttcctccaaatagagttgtttcttctgctttggaaactgttcaaaacttgttg
gctggttatgattatcctgctttcattttcaatgacaaactctcagaaaccatgttgtca
ctcagaaaactcggtgatagaaatgttattatccatgaaatgattgaaaagctttcagtt
ttgagaaaattcttaccagtatcattggttagagaagtcaataaccttttgcaaaagaga
aagattgaatacgacgaatattgttgcaaggatgataatgatcacacccaagatgtttac
aatgaggatttagttaaggaaattacttctattttcaagaactttgaaagtggtcttgaa
ggagctaagaaggaagaattcctcatcgctgccaaaccagtttttgaacttttggaactc
ttcaataatggatacaagcaacatgctttctccactctcgccaaattacttgaagaatat
attcaaactgaaaagatctttgataccactggtggtaagagaagagaagctgtttggttt
gaattgagacaaaaacactctgaaaacctcaacaagacttaccaaattggtctctcccac
tttagacttagcagtaagaataaggttattcgttctcttttagaaattattgaagaactc
gacatggttaaggaatcaactccacttttggatgaattggcttcatttgttgctccagaa
ttcagtgatgttgctgttgctgctaaacacatcctcacctcaagtagattgccttctaag
caaagaatgaaggatgaaatggaaggatactttaaggatggacttgaagctgttgataat
caacaaaagcttgcttgtttgaaggaattaattgtcaagtctaactatagtttcgacatt
cttcttgaattcttctctgatccagatgaaagaattgctaacttggctgctgaagtctac
atcagaaaggcatactgtacttttgatattgatatttcaagagttacctcccaaccaaag
ttcaagactgttgaatttagttttatgaatactgaaaagtccacttcaggttcattaaag
tctgatggtattgttggttctatttctatggactgtttgagcagtctctcagagactgaa
gataacattggttttggtgttttggctatctttgattctgtcagtgatattgatgctcac
cttccagatgttatgaagatctttgaaaataacgacgatgctgacaatactaatgttttg
aagattttgttgagagctcacggaccaacaccaaatgatgttgaacttctcccatccctt
actaaccttttgaagaagcacagcgaatctctccaatataacgaaattaagagagttact
gttgtcgttgaagttcaagataaattgccattctactttactttcagacaaagattcaac
tatgacgaagatccaatgtacagacatattgaacctacacttgccttccaacttttcctt
aagaaattatctaattataacattactccatacccatgtaaggatccatctgttcacgtt
ttctatggtcaaaagaagaaggagcttggtttgaatagatatgatttcttgaataagaga
ttcttcgttcgtactttggtattgcaaggtgatatcttcactgaagaaaatcctgaagaa
ttgcaaatttcagaacttgaaagatatgttgttgcctcaatcaatgctttggaaattgct
atggctgataagaattacccaactagttatgctaatcacattttcgtcaatttcttacct
gaagttgttgtcaaggcagatatggtaggtgaaattattgaaagattccaaaaggtttat
ggtaagagattgtggaagttgagagttagtgaagttgaagttagattcactgctaaattc
tcccgaacctctcaaccacaaacctttagattcattgctcttgatgacactggttacaat
cttacattggacgtttacagagaagaaaaggatcaaactactggtagaaccgtttacaag
actgttgttggtgaaaagaagccattggaaggtttggatgttaatattcctcaccctatt
ctccaagctgttgatcaaaagagagttcttgctcacaacaatgatacatcctatgtctat
gatttcccatacttgttcgaaagagttgttcgttccatgtggaaagaacataacgatttg
actaaggaagacattccaagcactttcatcagtcttactgaatatattctcgatacaact
ggcaaattcttgattgaaaatccagtcaagaatgctataggtaagaatacatgtggtatg
gttgtttggaaggttactttgttcactccagaagctaaggatggcagagatatgatttta
attgccaacgatatcacatatcaatctggttcttttggtgttattgaagatgaagtattc
caattggctagtgaaatggctagaaagttgaagattccaagattctacattgctgccaac
tctggtgctagaattggtttggctgatgaagtcagagaattattcaagattgaatggaac
gaaccaaatgatagcactaagggcttcaaatatctttacctcactccaaatgattacgaa
aaacttcaaaagaccaactctgtcaatgctgttgaaattgaagttaacggagaaaagaga
tggaagattattgacattattggtaaggaaaatggtattggtgtcgaaaatttgagagga
tctggtatgattgctggtgaaacttctcgtgcctatgaagaagttttcactatgaattat
attgctgcaagaagtgttggtattggtgcctatgttaatcgtcttggtcaaagaattatt
caaaatagaaaagctcctatcttgctcactggtgctggtgctttgaataaggttttgtct
agagaagtttataccagtaatttgcaattgggtggtattcaaatcatgaatcctaatggt
gtcactcacttgattgctaaggatgactatcttgctatcaaggatgctctcaagtggttg
tcatatgttccaaagtcagttggttctgcacttccaatcttgaagactcttgatgatcct
gaacgtcaaattcaatacctcccagttgaaggtagccactatgactttagagaaatgttg
gttggtaagactgttgaaggtgaaaatggagaatcaacatggttgagtggtttctttgat
aagaactcattctttgaaactttgactggttgggcaaagaatattattgttgctcgtgct
agacttggtggtattccaatgggtgttattgctgttgacacaaagacctatgaacaaatt
attcctgctgatcctgctgatagtaactctagagaaagagtagttcaaaaatctggccaa
gtctggtatccagattctgcattcaagactgctcaagcaatcaatgatttcaacaaggga
gaacaattgccactcatgatctttgctaactggagaggtttctctggtggtcaaagagat
atgtttgatgaaatcctcaagtttggttcttacattgttgatgctttgaccaattacaag
caaccagtttttgtttacattccaccaaatggtgaattgagaggtggtgcttgggttgtt
gttgatccaatgatcaataatgatgttatggaaatgtttgctgatgataagtccaagggt
ggtattttggaagcttctggtattgttgaaattaagtacagaaagcaagaaattgttgct
actattcaacgtttggatgctgaatatattaaccttgccaaggaattgggaagatcagac
atttctttgaaggaaaaggatgaaatcaaggtcaagatgggtaagagagttgaaaagttg
attccaatttatactcaagtagctgaatgttttgctgatctccatgatactccaggtaga
atgaaggctaagggtgttattaccgaaatcatttcttggaagactgctagaacttacttc
tactggagattgaagagaaagattctcgaattcaatttgttgaaggaattaagtgaatgt
gtagatgctcaatcaaacaagttatctatcaagagagaaatcctcagacaaaaggtcatc
aataatgaacaagtttggactaacgatagagaattcttgtcttggattgaagataataag
gaaactgttacacaagccattgctacattgagaggtgaaaaggtcaagcaagatattctt
tcattatgttcttcaggtaatttaggttcagtttgtgatggtttgctttccttcttggaa
aataacagtgatgctgttggtgaatctcttaaggaaaagctgagaaaattgctctaa

DBGET integrated database retrieval system