KEGG   Naegleria gruberi: NAEGRDRAFT_60479Help
Entry
NAEGRDRAFT_60479  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NAEGRDRAFT_60479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 368 aa AA seqDB search
MAEIIEINEKNAQFYVHYINFDKRLDEWVTIDRFNLDEDESVTKRDEDTRVERKLTRNMK
RQYNELHNVSTEIDVDNDPVQAALEKEHEEFTKVKNIQKIQFGKYEVETWYFSPYPEEYS
MIDKLYICEFSLKYMKSRRTYERHRDKCTLKHPPGDEIYRSGSLSFFEVDGKKQKIYCQN
LCLLAKLFLDHKTLYFDVEPFLFYVLCECDEEGCHMVGYFSKEKQSADGNNLACILTLPP
HQRKGYSKILIGFSYELSKIEGKEGTPERPLSDLGKISYRSYWKNVLLDILQAHSGISIK
EICKMTAIKQEDVLTTLQSLNLLKYWKGQHIISVAPKILEEHMKKQKRDEVKIDPSKIHW
SPYPLSQQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaattatcgaaattaatgaaaagaatgcccaattctatgttcactacattaat
tttgataaaagattggatgaatgggttactattgatcgattcaatttggatgaggatgaa
agtgttacaaagagagatgaagatactagagtggaacgtaaattaacgagaaatatgaaa
agacaatataatgaattacataatgtgtcaactgagattgatgtagataatgatcctgtg
caagcagcattggaaaaggaacatgaggaatttaccaaagttaaaaacattcaaaaaatt
caattcggaaaatatgaagttgaaacatggtatttctcaccatatccagaagaatactca
atgattgataaattatacatatgtgaattttctttgaaatacatgaagagcaggagaaca
tatgaaagacacagagacaaatgtactttaaaacatccacctggtgacgaaatatataga
agtggatctctaagcttttttgaagttgacggaaaaaaacaaaagatttattgccaaaat
ttgtgcttgttggctaaattatttttggatcacaaaactctctactttgatgtagaacct
ttccttttctatgtactttgtgaatgtgacgaggaaggatgtcacatggtaggatacttt
tcaaaggaaaaacaaagtgctgacggtaataatttggcttgtattctgaccttacctcct
catcaaagaaaaggttatagtaagattttaattggattttcatatgaattatctaaaatt
gaaggaaaggaaggaactccagaaagaccattatccgatctaggtaaaatcagttatcgt
agttactggaagaatgttcttcttgacattttacaggctcattcaggtatttcaattaag
gaaatttgtaaaatgacagccatcaaacaagaagatgtattgacaactttgcaatcactc
aatttactcaagtattggaaaggtcaacacattatttctgttgcccctaagattctcgaa
gagcacatgaaaaagcaaaagagagatgaagttaagattgatccatctaagattcactgg
agtccatatccactttctcaacaataa

DBGET integrated database retrieval system