KEGG   Naegleria gruberi: NAEGRDRAFT_60527Help
Entry
NAEGRDRAFT_60527  CDS       T01241                                 

Definition
histone acetyltransferase gcn5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NAEGRDRAFT_60527
Transcription machinery [BR:ngr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     NAEGRDRAFT_60527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 420 aa AA seqDB search
MFELLKKEIDDSTSIIFRPDFDDLYSGVDQSKSEKLSKPSKKSGNNNRKQNNQTDDERCS
RVVMVTTSTQILGPDLGSSASGSSNKGNEQTALRFEIVFNDGSVDSLQKLLAAKNIYGKQ
LPKMPKDYIARLVFDRSHRTIVGLQNGQIVGGISFRPFFPQGFSEIAFCAITGNEQVKGY
GTKLMNHLKDYCQTIGCYRFLTYADNFAIGYFKKQGFTKEISLDEKRYKGYIKDYDGGTL
MECVIRTDINYLDVPIMIVKQKQALQLKLKEVSNSDKVYPGIKLFKNGGKINGPEDVPGL
QEIGYQQETRSRDHKLHAAFVEVLEKLKRHEHSWPFLEPVDPEEVPDYYDVIKLPIDLST
IEQRLKKDYYRTKDIFVSDVRLIFENCRTYNSEQTEYYSAANKLEEYFKTIMSKILQQKN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaattattaaagaaggaaattgatgattccacatcaataatattcagacctgat
tttgatgatctgtactctggtgtagatcaatcaaaatctgaaaagctttcaaaaccttct
aaaaaatcaggaaataacaatagaaagcaaaacaatcaaactgatgatgaaagatgctcc
agagttgttatggtcacaacttctactcaaatattggggcctgatctcggttcatctgca
tcaggttcttcaaataagggaaatgaacagactgctcttcgttttgaaatcgttttcaat
gatggatcagttgatagcttgcaaaaactattggctgccaagaacatttatggtaaacaa
ttgccaaagatgcctaaggattacattgccagattggtttttgacagaagtcacagaacc
attgtaggtttacaaaatggacaaattgtaggtggtatcagttttagaccattctttcca
caaggattttctgaaattgctttctgtgccattacaggtaacgaacaagttaaaggttat
ggtacaaaacttatgaaccatttaaaggactattgtcaaacgattggttgttatagattt
ttaacatatgcggacaactttgccattggttatttcaagaaacaaggttttacaaaagaa
atttcactagacgaaaagagatataagggctacattaaggattacgatggaggtacactc
atggaatgtgtgataagaacagacattaattatttggacgtaccaattatgattgtaaaa
caaaagcaagcactccaactaaagctgaaagaagtttccaactctgacaaggtttatcca
ggtattaaattatttaaaaatggtggcaagataaatggcccagaagatgtgcctggcctt
caagagattggttatcaacaagaaaccagatcaagagatcacaaacttcatgctgcattt
gtggaggtgttggaaaaactaaaacgacatgaacattcttggccattcttagagccagtt
gatccagaagaagttccagattattacgatgttatcaagttaccaattgatttatcgaca
attgaacaacgtttgaaaaaggattactatcgtactaaggatatatttgtaagcgatgtc
agattaatctttgagaattgcagaacttacaactctgaacaaacagaatattattctgct
gctaacaaattagaggaatactttaaaacaattatgagcaagattttacaacagaaaaat
taa

DBGET integrated database retrieval system