KEGG   Naegleria gruberi: NAEGRDRAFT_63473Help
Entry
NAEGRDRAFT_63473  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
ngr  Naegleria gruberi
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NAEGRDRAFT_63473
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NAEGRDRAFT_63473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 464 aa AA seqDB search
MKYITLLLLILSITIVVDNRPIQTHTSTRHQEEIGNLFDLFRPGFQYTGNHSINNVKINT
KSNIQYSPIILVGGLGGSALMSQRNQSTSEPHWWCEKTTDPFQIWLSVKEMVPFFTEDCF
VNDMSLILKDGLVRQKDSRVKIFGKDVGGLDGLNSILSEFQSKFYYMKPIADFLVANGNY
QVGKSLRGFTYDWRLSVREWANNTNSVGGDFFILKKLIEDTYTINGNVKVSLLGHSMGAP
FLQYFLANFVNQAWKDQYIYNYIPVAGPFDGSPFSLILFALGTNWQIPTFEFEKARKIVR
EFPSVLFMSPNKFPYNYPFFTYGTQNYHVELSDIENFFSNAQVPNGYKLYQHEYSQYKNN
RYNAPNVTTHCIYGYGIPTVTHIEYSGSKELKDLTYKDVLNNMNTVNREDGDGTVPLYSM
QICDEFAKYQQQQVHVHRFFNSTHGSIMNEERVFRTILNILQFN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacatcactctactactgttaatcctttctattaccattgttgttgacaatcgt
ccaattcaaactcatacaagtacaagacaccaagaagaaattggaaacttatttgattta
tttagacctggttttcaatacactggcaatcattccatcaataatgttaaaatcaatact
aaaagtaatatccaatattcaccaatcatactagttggtggattgggtggttctgcactc
atgtcacagagaaatcaatcgaccagtgaacctcattggtggtgtgaaaaaactactgat
ccatttcaaatctggttatctgttaaagagatggttcccttctttacagaagattgcttt
gtcaatgacatgtcgcttatattgaaggatggattagttcgccaaaaagattcacgtgtg
aagattttcggaaaggatgttgggggattggatggattgaattcaattctctctgaattt
caaagcaagttttactacatgaagccaatagcagatttcctcgttgcaaatggaaattat
caagttggaaagagtttgagaggtttcacatacgattggagattgagtgtgagagagtgg
gcaaataataccaattctgttggtggagatttcttcattttgaaaaaactgattgaggat
acttataccattaatggaaatgtgaaggtttcactattgggacattcaatgggagcacct
ttcttacaatatttccttgccaactttgtaaatcaagcatggaaagatcagtatatttat
aattacattccagtggctggtcctttcgatggaagtccattttcattgatactattcgca
cttggaactaattggcaaattccaacattcgaatttgaaaaggcaagaaaaattgtcaga
gaatttccttcagtattattcatgtctccaaacaaatttccttacaattatccatttttc
acctatggaactcaaaattatcatgttgagctttcggatattgaaaatttcttttcaaat
gctcaagttccaaatggatacaaactctaccaacatgaatacagccaatacaagaataat
cgatataatgcacctaatgtaaccacccattgcatctatggttatggaattccaacagta
actcacattgaatattcaggcagcaaggaattgaaagacttgacctataaagacgtcctc
aacaatatgaatacagtgaatagagaagatggtgatggaactgtgccattatattcaatg
caaatttgtgatgagtttgccaaatatcaacaacagcaagttcatgtccatcgatttttc
aattccactcacggaagtatcatgaatgaagagagggtcttccgaaccattctgaatatt
ctccaatttaattaa

DBGET integrated database retrieval system