KEGG   Naegleria gruberi: NAEGRDRAFT_65261Help
Entry
NAEGRDRAFT_65261  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NAEGRDRAFT_65261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 491 aa AA seqDB search
MEPFAKKKKLSISGTATNEEQLTDSGSSIHNTSQETKKFNKLNKMVEMEGAESHEDDLED
FEEQDEASDVSRDDELTCSANDVIRFRLVRNESDIEQQYIDTNDVEHHHKLMEFHPQFTY
QLFGEEEKIDGYENLRINFYFTKSLYCWFNVQYDTKSDDATDVKSIFAAKELEFQFSEFS
AVPLYFPYTENLSEFKSKINQPNTPKGEQIDVYYRDGKVFEIYKCTMSQIAALHKPWQFL
CLFFIEGTSYIDDQDNLWEFFLVYEKIKDHENNFEYIPVGFSSIYPFFTLKKEDGVLKDK
RRLRVSQFLILPPFQRQGHGRKLLLAIYTYAIKGYKEQKSLIGYNALQNVEEKTYEPREC
YEVTVENPGDEFQLMRNKVDVEVCGPIFKAAKRKADEKEGETFEEFKARAKPLTKLSDTQ
LRKCFEVLWLKHLNDNVNTTQNDRNELKLFIKKRLYSEYDMEGAFEDHKERKEKLEELCE
GEIDEYKVLLK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggaaccatttgcaaagaagaagaagctctcaatttctggcacagcaaccaacgaagaa
caactcaccgatagcggaagcagtattcacaatacttcacaagaaaccaaaaagtttaac
aagttaaacaagatggttgagatggagggtgctgaatcccatgaagatgatcttgaagat
tttgaagaacaagatgaagcatcagatgtaagccgtgatgatgaattaacgtgtagtgcc
aacgatgttattcgcttccgtcttgtcagaaacgaatccgatattgaacaacaatacatt
gatacaaatgatgtagaacatcatcataaattgatggaattccatccacaattcacctat
caattatttggagaagaggaaaaaattgatggttatgagaacctccgaattaatttctat
tttactaaatcattatactgttggtttaacgttcagtatgacactaagagtgatgacgca
acagatgttaaatcaatctttgctgcaaaggagttggaatttcaattctcggaatttagt
gcagtccctctctacttcccatatactgaaaatttatctgaatttaaatccaagataaat
caaccaaatacaccaaaaggagaacaaattgatgtttattatagagatggaaaagttttt
gaaatttacaaatgtacaatgtcacaaattgcagcacttcacaaaccatggcaattcttg
tgtctattctttattgaaggaacttcatatattgatgatcaagataatctatgggaattc
tttttagtatatgaaaaaattaaggatcatgaaaataatttcgaatatatacctgttggt
ttctcatcaatatatccattctttaccctgaagaaagaagatggtgtattaaaagataag
agaagattgagagtgagtcaatttttaatattgcctccattccaacgtcaaggacatgga
agaaaactcctccttgcaatttatacatatgccatcaagggttacaaggaacaaaagagt
ttgattggatataatgctcttcaaaatgtggaagaaaagacctacgaaccaagagaatgc
tatgaagttactgtggaaaaccctggtgatgaattccaattaatgagaaataaggttgat
gtagaagtatgtggtccaatatttaaagcagctaagagaaaggcagacgaaaaggaagga
gaaacatttgaagaatttaaagctagagctaagccactcacaaaactctctgatactcaa
ctcagaaaatgttttgaagtcctgtggctgaaacatctcaatgacaatgtaaatactacc
caaaatgacagaaatgaattgaaattatttatcaagaagagactatacagtgaatacgat
atggaaggtgcatttgaggatcacaaagaaagaaaggaaaaattagaggaattatgtgaa
ggagagattgatgagtacaaggtgttactgaaataa

DBGET integrated database retrieval system