KEGG   Naegleria gruberi: NAEGRDRAFT_66580Help
Entry
NAEGRDRAFT_66580  CDS       T01241                                 

Definition
silent information regulator family protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     NAEGRDRAFT_66580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 452 aa AA seqDB search
MPSTTTSSSKASSSTSSNTSSNTSGKKISPASSSSSGTTREKTASSRKGESTSTDFSTLI
KTNPKLSAKPITNKDGDDITEYFDETNVLNAKIEHLVNLINQSKHIVLYTGAGISRAAGI
RDYRSPNGVWTMKEKGVKTVAKKDESKIIFPTRTHMAISTLYNAGKIQYVTSQNVDGLHV
KSGIPRKNMSELHGNTNVEICHKCNIEYVRNFRCRNNKNVHDHRTGRFCEKCKSELEDTI
INFNENLPTDQLERAEENASKADLAIVVGTSMRVNPACSLPQMCKENGGKLVIINLQLTP
KDKKADLRIFAEADKVIDTVMKKLALEIPPFILETEYSLESFESVNPTSEKKLIGFKITS
PSPLGPMGSKVLRSISLKVHGSKVVSFKDTMMLDPIPSDCTKISAVLKYNLNSIDEKEAK
CTIELENPLNITSKSFALKVNTSTNEITVTEK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaacaaccacttcatcatcaaaagcaagttcctccacttcatcaaacacttca
tcaaatacttcgggaaagaagatttcacctgcttcttcatcgtcatctgggacaacaaga
gagaaaactgcttcatcaagaaagggagaatcaacaagtactgatttttctacccttata
aaaaccaatccaaaactttctgccaaaccaattaccaataaggatggagatgatataaca
gaatattttgatgaaactaatgttttgaatgccaagattgaacatttagtcaatctcata
aatcaatccaaacatattgtattatatacaggtgctggtatcagtagagcagcaggtatt
agagattacagatctcctaatggtgtttggactatgaaagaaaagggagtaaaaactgta
gcaaagaaggatgaatcaaagataatcttcccaactcgtactcacatggctatttctaca
ttatacaatgctggaaagattcaatatgtaacttctcaaaatgttgacggattgcatgtt
aaatcaggaattccaagaaagaatatgagtgaattgcatggtaataccaatgttgagatt
tgtcacaaatgtaacatagaatatgtccgtaattttagatgtagaaataacaagaatgtt
cacgaccacaggactggaagattctgtgaaaagtgtaaaagtgaattggaagatacaatt
attaatttcaatgaaaatttaccaactgatcaattggaaagagcagaggagaatgcttcc
aaggctgacctggctattgtcgtaggaacaagtatgagagttaatcctgcatgttccctt
ccacagatgtgtaaagaaaatggaggaaaattagtcattatcaatctccaattaactcca
aaagacaagaaggcagatttgagaatttttgcagaagctgacaaggttattgatacggta
atgaaaaagctggctttggaaatacctccattcattctagaaactgaatattcattagaa
agctttgaaagtgtcaatccaacaagtgagaaaaagttaattggattcaaaattactagt
ccatctcctttaggaccaatgggttcaaaggtattgagatcaatcagcctaaaggttcac
ggctcaaaagtagtgagctttaaggatactatgatgctcgatccaattccatccgattgt
acaaagatatcagcagtactgaagtataatctgaattcaattgatgagaaggaagccaaa
tgcactattgaactggaaaatccactgaacattacttcgaaatcctttgctttaaaggtg
aacacatcaaccaatgaaattacagttacagaaaagtaa

DBGET integrated database retrieval system