KEGG   Naegleria gruberi: NAEGRDRAFT_66851Help
Entry
NAEGRDRAFT_66851  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ngr  Naegleria gruberi
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NAEGRDRAFT_66851
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NAEGRDRAFT_66851
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     NAEGRDRAFT_66851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 937 aa AA seqDB search
MLAQPRSEEFDTESSLSQNQQQDQLVFIDEEEEQDENQATIQITGNNLISSAASDQSETL
SSIILPMQSYCWHLEIMDKSQHLFPSLQKTTIPLRAQTYSIGEMFHFLPGALRFLTMSYV
PEKLIKKRETPFDFIMRRAVVDPRRKGPPIGGIGAGMFTLGMNGWFTRSHLIFNQTGGIY
SDTVLPVNQFSLRVERNGEIESFVLNPICEFKDGTMDKDLIKKLKHNWMFINDERRRKNK
MQFSQQVYSLFPKSWTVYQTSDEKFTVICERYSPVWAHNYQESSFPTCNFEWTIINNTDE
EANVSLLFTIQSEEKFRKKNEQSIIARNETDSVKCLTIETTVTDSFSHKDTIQFCIGANT
SLGSITFLDEFNGTNESHLHDLWQEFNNNGEFSTEFCENFAKRHDWTKSQSKHLSCHAIC
SKVQIPSNSSKQVCFNLNWNAPFVRFGPTMEFRYLRHYTQFCTDAISSITQHKDTACFEM
CKRSLDSSKQWKDEISQWHQGVIDQVGKDHPTAVAALFNELYYIVDGGTLWTNGGELDEN
GNSQDSKDYFFYLEGHEYLMCNTYDVHFYASHAMIMNWPEIQLSIQRDIIRAVREENNQE
VTFYLSNMKNRRKVKGSVPHDVGTPYERPWKLVNAYNFQDVNKWKDLNSQFILTIFRDFM
ITKNREFLEEAFPSIILALNYSLTNFDKDGDGLIENESFPDTTYDAWKVTGVSAYSGMLW
IASLKAILEMAKELDDENTRQKVEPLIESGLKTFESKLWDETNQYYHYDASTEPQHDSIM
SDHLHGTFMLLLIGNYVKNSGRCEDSHYLIPFNMERVSKSLNKILENNFVKYQQITKLGG
CVNGMRPTQEVDKTSLQSREMWTGTSYVVAALTILLGRREEGIDLMKSVFDKCWSSNSAF
WFQTPEAVTETGEYRALGYCRPLSIWSCLSAMMNKKI
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcacaaccaaggagtgaggagtttgacactgaatcttctctatcacagaatcaa
caacaggatcaactcgtttttattgacgaggaagaagaacaagatgaaaatcaagcaaca
atacaaataacaggaaataatttaatatcttcagcagcatccgaccaatccgaaactcta
tctagcatcattcttccgatgcagtcctattgttggcatttggaaattatggataaatca
caacatttatttccgtccctgcagaaaacaacaattcctctccgagcacaaacctattca
attggagaaatgtttcacttccttccgggtgctttgagattcctgaccatgtcctatgtt
ccagagaagcttattaagaagagggaaacaccgtttgattttattatgagaagagcagtt
gttgatccaagaagaaagggaccaccaattggtggaattggagcaggaatgtttactttg
ggaatgaatggatggtttacgaggagccatttgatttttaatcagacaggtggaatttat
tcggatacagtcttgccagtcaatcagttcagtttgagagtggaaagaaatggtgagatt
gagtcgtttgtgttgaatccaatatgtgaatttaaagatggaactatggataaggattta
attaaaaagttgaaacataattggatgtttattaatgatgaaagaagaagaaaaaacaag
atgcaattttcacaacaggtgtattctctatttccaaagtcgtggactgtctatcagaca
agcgatgaaaaattcacagtaatatgcgaaagatattcacctgtgtgggctcacaattat
caagaatcaagttttccaacatgtaattttgaatggactattatcaataacacagacgag
gaagcaaatgtttcattattatttacaattcaaagtgaagaaaagtttagaaaaaagaat
gaacaatcaataatagctagaaacgaaactgactcggtaaagtgtttgacaatagaaact
acagtaacagattcgttttcacataaggatacaatacagttttgtattggagccaacaca
tctttgggatcaataacatttttggatgaatttaatggaacgaatgaatcccatttacat
gatttgtggcaagaatttaacaataatggagaattttcaacagagttttgtgaaaatttt
gctaaaaggcacgattggactaagagccaatcaaaacatttgtcttgtcacgcaatttgt
agcaaagtacaaattccttcgaatagttccaaacaagtttgtttcaatttgaattggaat
gcgccatttgttaggtttggtccaacaatggaattcagatatcttagacattatacccag
ttctgtactgatgccatttcttccatcacacaacacaaggatactgcatgctttgaaatg
tgcaagagaagtttggattcatctaaacaatggaaagatgaaatctcacaatggcaccaa
ggtgtaattgaccaagtcgggaaggaccatccaacagctgttgcggctctattcaatgag
ttatactatattgttgatggaggaaccttatggaccaatggtggagaactggatgaaaat
ggtaatagtcaagactcaaaggactactttttctatttggaaggacatgaatatttaatg
tgtaacacatatgatgtacatttctatgcctctcatgccatgattatgaattggccagaa
atacagctttctattcaacgagatatcattagagctgtcagagaggaaaacaatcaagag
gttaccttttatctatcaaacatgaaaaataggagaaaggtcaagggaagtgttccacat
gatgtcggtactccatacgaaagaccatggaaactagttaatgcctataacttccaagat
gtcaacaaatggaaagatcttaatagtcaatttattttaactattttcagagattttatg
attacaaagaatagagaatttctggaagaagcattcccctctataattcttgctctcaac
tacagcttgaccaatttcgataaggatggtgatggattgattgaaaatgaatcattccca
gatacgacatacgacgcctggaaagtaacaggtgtttctgcatactctgggatgttatgg
attgcatctttgaaagctattttagaaatggccaaagaactggacgatgaaaataccaga
caaaaggtagaaccattgatagaaagtggcctgaaaacattcgagagtaaattatgggat
gaaactaatcaatactatcactatgatgcaagtactgagccacaacatgactctatcatg
tcagaccatttacacggcacattcatgttattgcttattggaaattatgtgaaaaatagt
ggaagatgtgaggattcacactacttgattccattcaacatggaaagggtttccaaatca
cttaacaaaatactggagaataactttgtaaaatatcaacagattacaaaacttggagga
tgtgttaatggtatgagaccaacacaagaggttgataagacaagcttgcagtctagagag
atgtggacaggaacatcgtatgtcgtagctgctttaacaatcttgcttggcagacgagaa
gaaggaatagatttgatgaagagtgtttttgataaatgttggtcctccaattcggcattc
tggttccaaactcctgaggcagtaacagaaacgggagaatatagagcccttggatattgt
agacctctctcaatttggtcttgcctttcagcaatgatgaataagaagatttaa

DBGET integrated database retrieval system