KEGG   Naegleria gruberi: NAEGRDRAFT_68362Help
Entry
NAEGRDRAFT_68362  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ngr  Naegleria gruberi
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ngr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ngr03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 532 aa AA seqDB search
MSFNASSSSQPTKSVNEGLDSSDNIFSYLLTLTPDELNLLYGHTWTCKAVFRFLPDIAKQ
YVMRMLLCGSINSQQIAMDIPKKLTNLSGYLDSNGAKKGREQDQEAILQEVRDAHENAFS
QLLKYRIISKTSNSDFTLNRYFQDTFRNLVTSVPSAQAPTTSHSSSHKRKEQEPETSISE
ENMDELEPKKKKRKKHKTKEIGAEFLQEYSKRKWENVLLYLVGTAAESEQTFSGNVNELL
KYSQLIKKSDTVRITNEGFQFLLQETKVQVWKLLKHYLETSGQRNQVKNEILNFIFELGF
LDVGKEYSSKDLTSTQKSLLVDFNDLGIIYLHRDKKKKIKDKYFFPTPLAKSLTVSMSTS
YDLISSFGSHNSINNGYIIVETNYRVYAYTNSPLQIALLSLFIFPEYRLPNMVVGLITRS
TIREALKNGISAHQILQFLRLNAHPQMRLKKPVIPDTVSDQILLWEKERNRVIKTTSVVY
DKFTNVSELNATVDYARRQGALLWHSEEKMMMVCKREFHGLMKEFISSQYSR
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaacgcttcttcatcatcacaacctacaaaaagtgttaatgaagggttggat
tcatcggacaatatattttcctatttattgactttaacaccagatgagttgaatttattg
tatggtcacacttggacatgtaaagctgtgtttagattcttgccggatattgctaaacaa
tatgtgatgagaatgttgttgtgtggtagtattaatagtcaacaaattgctatggatatt
cctaaaaaacttactaacttgtctggatatctcgattccaatggagcaaagaaaggaaga
gaacaagatcaagaagcaattttacaagaagtaagagatgctcacgaaaatgccttttca
caacttttaaaatatagaatcatttcaaaaacatcaaattccgattttacactcaataga
tatttccaagatacatttaggaatttagtcaccagtgtaccatcagcacaagctccaaca
acaagtcactcctctagtcacaagaggaaggaacaagaaccagaaacaagtatatcagaa
gaaaatatggatgaattggaaccaaaaaagaaaaagagaaaaaagcacaagactaaggaa
attggagctgaattcttacaagaatattctaaaagaaaatgggaaaatgtactgttatat
ctagtaggaacagcagctgaatcagagcaaacattctcaggaaatgttaatgaactgctc
aagtattcacaattaatcaaaaaatctgatactgtaagaattaccaatgaaggtttccaa
tttttacttcaagaaaccaaagttcaagtttggaaacttcttaaacattatcttgaaaca
tctggacaaagaaatcaagtcaagaatgaaattcttaattttattttcgaattgggattt
ttggatgttggaaaagagtatagtagtaaggatctgacaagtactcaaaagagtttactc
gtcgattttaatgatcttggtataatttatcttcacagagataaaaagaagaagattaaa
gacaagtacttcttcccaacacctctcgccaaaagtttgaccgtctcaatgagtacaagt
tatgatttgatttcatcatttggatctcacaatagtatcaataatggatatattattgta
gagaccaactatagagtttatgcctatactaattctccactccaaattgctctcctttcc
ctatttattttccctgaatatcgtttaccaaacatggttgttggattaattacaagaagt
acaatcagagaagctttgaaaaatggtatcagtgcgcaccaaattcttcaattcttaaga
ttgaatgctcaccctcaaatgagactaaagaagcctgtcattcctgatactgtctctgat
caaattctcctctgggaaaaggaaagaaacagagttatcaagactaccagtgttgtatac
gataaatttaccaatgtaagcgaattgaatgccaccgttgactatgcaagaagacaagga
gctcttttgtggcacagtgaagaaaagatgatgatggtttgcaagagagaattccacgga
ctgatgaaggaatttatttcaagtcaatattctagataa

DBGET integrated database retrieval system