KEGG   Naegleria gruberi: NAEGRDRAFT_69820Help
Entry
NAEGRDRAFT_69820  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ngr  Naegleria gruberi
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ngr00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 560 aa AA seqDB search
MTQQAAEEEITLVVNDNDSGVVAVEDQQHSEQQKQLTAIDNYSLNNNDQNLIGFKPITLD
SNLRYRNKKFKAELNGDFLILRNLEGKKSNDNLVPLLTIEMESIFAVHKKTDQPLVFVVF
TFRAKDCKKIVYEFEALGNEECAEWVDSIRSNAFKTNLIMSGSKSFGNRRVLLFINPFSG
KKTGTKIFEKQIKPMLDVAHLSYDAIITERADHAFEFCSTSDKILEYTDICGMGGDGIIY
EIINGIGKRKDWKNVFDRVRIGHIPGGTSNALAVFSGSQVKSGKPAVPEMAAFIIARGFH
QPMDLLSCFQEANKRYISFLSITWSAIADVDIGTENMRWLGAARNTVGAIKQIMNKKAYR
GKLKYVQQSQELKRVKSLKNIRENEQRYSSYTESSIEFLQGKENEKGQLSCPLLEQYFHE
EFKKLAPEYCSEKEPNITEDSTNSHLEVKEIEDRFCMFLAANISHISFDFIASPMAHHHD
GYIDLVYVKDDISRGDFLNIFLAAEKGDHIFEKCVDLSKVKAFMLTPIDTGSFVVVDGEA
VDYSPILVEVHPSCCKLLTL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaagcagcagaagaagaaatcacactcgttgtgaatgacaatgattcggga
gttgtagctgttgaagatcaacaacattccgaacagcaaaaacaattaaccgccattgat
aattattctcttaataataatgatcagaacctcattggattcaagccaattacattagat
tccaacctccgatatcgaaataagaaattcaaagcagagttgaatggtgattttctgata
ttgcgaaatttggagggaaagaagagcaacgacaatttggtgcctctcttgacgattgaa
atggaatctatatttgctgttcataagaaaacggatcaacctcttgtgtttgttgtgttt
acatttagggcaaaggattgtaagaagattgtttatgaatttgaggctttggggaatgaa
gaatgtgcagagtgggttgatagtattagatcgaatgcttttaaaactaatttaatcatg
tcgggatctaaatcatttggaaatcgtagagttttgctttttattaatccattcagtgga
aagaagactggaaccaagatttttgagaaacaaatcaagccaatgcttgatgttgctcat
ctttcatatgatgcaattattacagagagggcagatcatgcatttgagttttgttctacc
tctgataagattttggaatatacagatatttgtggaatgggaggagatggtattatttat
gaaataatcaacggaattggaaagagaaaggattggaagaatgtatttgatcgtgtcagg
attggtcatattccaggaggaacttccaatgctttggctgtattttctggatctcaagtt
aaaagtggaaagccagcagttcctgaaatggccgcctttattatcgccagagggttccat
caacctatggatcttttatcctgttttcaagaggccaataagagatacatctcattcctg
agtattacttggagtgctattgcagatgtggatattggcactgaaaatatgagatggctg
ggtgcagccagaaacacggtcggagctatcaaacaaattatgaacaagaaggcatacaga
ggaaagcttaaatatgttcaacaatctcaagaattgaaacgtgtaaaatctctgaaaaac
attcgagagaatgaacaaaggtattcatcctatacagagagtagtattgaatttttacaa
ggaaaggaaaatgaaaagggtcaactaagttgtccactcttggaacaatatttccatgag
gaatttaagaaattggctccagaatattgttctgaaaaggaaccaaatatcactgaggat
tccaccaattctcacttggaagtcaaagaaattgaggacagattttgcatgttcctggcc
gccaatatttcacacatttcctttgatttcattgcctcaccaatggctcaccatcatgat
ggttacattgatttggtctatgtgaaggatgacatttcaagaggagatttcctcaatatc
tttttggcagcagagaagggagatcatatttttgaaaagtgtgttgatttgtcgaaagtg
aaggcattcatgcttacaccaattgatactggatcgtttgttgttgtggatggagaggct
gttgattatagtccaatacttgtagaggttcatccttcttgttgtaaacttttaactttg
taa

DBGET integrated database retrieval system