KEGG   Naegleria gruberi: NAEGRDRAFT_70491Help
Entry
NAEGRDRAFT_70491  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ngr  Naegleria gruberi
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NAEGRDRAFT_70491
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    NAEGRDRAFT_70491
   00603 Glycosphingolipid biosynthesis - globo series
    NAEGRDRAFT_70491
   00604 Glycosphingolipid biosynthesis - ganglio series
    NAEGRDRAFT_70491
   00511 Other glycan degradation
    NAEGRDRAFT_70491
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NAEGRDRAFT_70491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 552 aa AA seqDB search
MVESRRIISPFKTNTDNVDTFKVFPLPDQYSTGSIVGIIPDWKNFNIAFQQNPESPGDFD
IISDAFERYGGMIFYNQAVDSSATCPTLNGTKVYCMNRAVLTILKGSTDLIPKPFLGMDE
SYAITVNPSDGFIQMTANTVWGGLRALESISQLIVPTDNMNGVDFGKVYYSFAEYLPILI
KDQPRFSWRGFLVDTSRHYYSVKKILQIIDSLAYLKMNVFHWHIVDAQSFPLVVDAYPNL
SGKGAYQKKAVYSAEDILAITEYGRRRGVRVIPEIDIPGHAGSWGFGYPEITANCPSYKH
NINNIPLNIAEPKTYQVLGAIIKQLVQNGFSDQYYHFGGDELVMGCWLQDPSILSFMKQK
GFTQPVQLLHYFEDNLRTLYKPYNKTMICWEELALEYGYNLPKDTIVHVWKERHTLIDVV
KMGYQTLLSGGWYLDQQIPNHNQTFYEWVDTWINFYQNDPTEGFGMTDSQKKLVLGGEGA
MWSEQVDDANFDSRVFPRTLAIAERLWSSSSVTDLTSARIRMEYSRCNVLVRRGVNAGPV
MPGYCQATYDNF
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggtggagagtagaagaataatatcaccattcaagacaaatactgataatgtagataca
tttaaagtgtttccacttcctgatcaatattcaacaggatcaattgttggtataatccct
gattggaagaatttcaatattgcttttcaacaaaatccagaatcacctggagattttgat
attatttctgatgcattcgagagatatggtggaatgattttctataatcaagctgttgat
tcatctgcaacttgtcctacattgaatggtacaaaagtttattgtatgaatagagctgtt
ttgactattcttaaaggaagtactgatttaattccaaaaccattccttggtatggatgaa
agttatgctattactgtcaatccaagtgatggatttattcaaatgacagctaatactgtt
tggggaggtctcagagctttggaatcaatttcacaacttattgtgccaactgacaatatg
aatggagttgattttggaaaggtttattattcattcgctgaatatttacctattctaatt
aaggatcaaccaagattttcttggagaggatttcttgtagacaccagtagacattattac
tctgttaagaagattttgcaaatcattgattctcttgcctatttaaagatgaacgttttc
cattggcatattgttgatgctcaaagcttccctcttgtcgtcgatgcctatccaaacctc
agtggaaagggtgcctatcaaaagaaggctgtttactctgctgaagatattcttgccatt
actgaatatggtagaagaagaggtgtcagagttattccagaaattgatattccaggtcat
gctggatcttggggatttggttatcctgaaattactgccaactgtccaagttacaagcac
aacatcaataatattccactcaatattgctgaaccaaagacttaccaagtgttaggagct
atcatcaagcaattagttcaaaatggattttctgatcagtactaccactttggtggagat
gaactcgtcatgggttgttggctccaagatccaagtattctatcattcatgaagcaaaag
ggattcacacaaccagtccaattgttgcactactttgaagataatttgagaaccttgtac
aaaccatacaataagactatgatttgttgggaagaactcgctttggaatacggatacaat
ttgccaaaggatactattgttcatgtttggaaggaaagacacactcttattgacgttgtc
aagatgggttaccaaaccttgttgagtggtggttggtatttggatcaacaaattccaaac
cataatcaaactttctatgaatgggttgatacttggattaatttttatcaaaatgaccca
actgaaggatttggtatgactgatagtcaaaagaaattagttttgggtggtgaaggagcc
atgtggagtgaacaagtcgatgatgccaactttgactctcgtgtcttccctcgtactctt
gctattgctgaaagattgtggagtagtagttctgttactgacctcactagtgccagaatc
agaatggaatacagcagatgtaacgtcttggttcgtagaggtgtcaatgctggtccagta
atgccaggttattgtcaagctacttatgataacttctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system