KEGG   Naegleria gruberi: NAEGRDRAFT_70927Help
Entry
NAEGRDRAFT_70927  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ngr  Naegleria gruberi
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NAEGRDRAFT_70927
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     NAEGRDRAFT_70927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 873 aa AA seqDB search
MKRKFVTPFKNPPPPKAEDKSSATPTTTDVAKSSQSNASQDVPKANSTTTTTAKKKFVPP
TRTKPSEPTSTSNANNNNNNSSNNDEEEGEVWMVMHTKNSNKKHKTFDDGFLLIRNKKYT
LFDSQGKQLIAKSVSKVETFRENDQLTLGTKLVDFQSKLKMEDYISGRIFLQYQSNITTP
KVNTISSAAKTEFKRHTTSKTAGLGYNNTEVQVIKAPEGAYILNENHPEKDKNGKKLSDV
FIDNFLGENLRPHQVEGVKFMYECAMGLKDFVGKGCLLADEMGLGKTLQTITLIYTLLRR
GPFGSPIIKKAIVVTNSSLVKNWTSEFDKWVGEDKIKVLTVTTKTAKQSPSETLKIFKAG
YHQVLIISYNLCTNYVEELQDCQCDILICDEGHKLKNANIKIFQTLKKISTPRRIVLSGT
PLQNDLNEFFTICDFINPGLLGDATSFKNLFTEPIKKSQEPNAKKQDKVIGENRSKELNK
IVSQFVLRRTNLLLRQHLPPKMEIVLFCGMTELQENLYKHFVLSKALRGVINGTLDSNNA
LACIMHLKKLLAHPNMIYPQENNEEKEEEDNELFDDIWTQSKKHFPSDYNPNDKKEYHSQ
YSGKLLVLDNLLREIREVGDRVVIVSNFKSILNEIEKLCKIRDYPLSRLDGSTQSEKRMV
IVNSFNSPKSNDFIFLLSSKAGGCGLNLIGANRLIMIDPDWNPSNDEQAMARVWRDGQKK
SVFIYRMIGCGTIEEKIFQRQIVKTGLSKSTLDEKSLKSQFSSEMLKELFKYDNDMDCKT
YPADSNDLDAIKEKDEVLAKVLDEEDVKIPFVKITLDTEDSKNQSNETTEESNVEDEEES
SEEDSLESDTKKRKIDMEEGEEEFKFIDEDEDE
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaagtttgtcacacccttcaagaatccacccccaccaaaggctgaagacaaa
tcgagtgcaacaccaacaacaaccgatgtagctaaatcttcacaatcaaatgctagtcaa
gatgttccgaaggctaattcaacaactacaacaacagcaaagaaaaagtttgtcccacca
acaagaacaaagccttcagaacctacctctacctccaatgctaacaataataataataat
agttcaaataatgatgaagaggagggagaagtgtggatggtcatgcatacaaagaattca
aataagaaacataaaacatttgatgatggtttcttattgataaggaacaaaaagtacaca
ttgtttgattcacagggaaaacaattgattgccaagtctgtttctaaagtagaaactttc
cgagaaaatgatcagctcacccttggaactaaactagttgattttcaatccaagttgaaa
atggaggattacattagtggtagaatattccttcaatatcaatccaatatcacaacacct
aaagttaatacaatatcatcagctgccaagactgaattcaaacgtcatactacatccaag
actgcaggtttaggctacaataacacagaagttcaagttatcaaggcacctgaaggagcc
tacattttgaatgaaaatcatcctgaaaaggataagaatggaaagaaattatctgatgtt
tttattgataattttcttggagaaaatctcagacctcatcaagttgaaggtgtgaaattt
atgtacgaatgtgccatgggattgaaagattttgttggaaagggttgtttgttggcagac
gaaatgggtttaggtaaaacccttcaaaccattactttaatctatacattactcagaaga
ggtccatttggatcaccaattattaaaaaggccattgttgtaaccaattcatctctcgta
aagaattggaccagtgaatttgataaatgggttggagaagataaaatcaaagtattgaca
gttactaccaaaacagctaaacaatctccatccgaaactttaaagattttcaaagctggc
taccatcaagtattaatcatttcatataatctctgtaccaattatgtggaggaattgcaa
gattgtcaatgtgatatacttatttgtgatgaaggtcacaagttgaagaatgctaatatt
aagattttccaaactctgaaaaagatttctactccaagaagaatagtactcagtggtaca
cctttgcagaatgacttgaatgagttctttaccatttgtgactttatcaatcctggtttg
ttgggtgatgcaacatctttcaagaatctcttcactgagccaattaaaaagagtcaagaa
ccaaatgctaaaaaacaagacaaggttattggtgaaaatagatccaaagagttgaataag
attgtttctcaatttgttttgagaagaaccaaccttttattgagacaacatttacctcca
aaaatggaaattgtattattctgtggtatgactgaattacaagaaaatctttacaaacat
tttgtactctccaaagctctgagaggtgttattaatggtactttggattcaaacaatgca
ttggcttgtattatgcacttgaagaaattattagcacatccaaatatgatctacccacag
gaaaacaatgaagaaaaagaggaagaggacaatgaattattcgatgatatttggacccaa
tcaaaaaagcacttcccatctgactacaatccaaacgacaagaaagaatatcattcccag
tattctggaaagctacttgttcttgataatctattgagggaaatcagggaagttggagat
agagtagtaattgtttctaactttaaatctattctgaatgaaattgaaaaattgtgtaaa
ataagagactatcctttgagtagattggacggatcaactcaatcagaaaagagaatggta
attgtaaatagtttcaactcaccaaaatcaaatgactttatattcttgctttcatccaaa
gctggtggttgtggtctcaatttaattggtgctaacagacttattatgatagatcctgat
tggaatccaagtaatgacgaacaggccatggctcgtgtttggagagatggtcaaaagaag
agtgttttcatctatagaatgattggttgtggtactattgaagaaaagattttccaaaga
caaattgtcaagacaggtctgtctaaatctacccttgatgaaaagtctctcaaatctcaa
ttttcgagtgaaatgcttaaagagctgttcaaatatgataatgatatggattgtaaaaca
taccctgcggatagtaacgaccttgatgcaattaaggaaaaagatgaagttttagctaag
gtgttagacgaggaggatgtaaagattccttttgtcaagattacattggatactgaggat
tccaaaaatcaatcaaacgaaacaaccgaagaatcaaatgtggaagacgaagaagaatcc
agtgaagaggattcacttgaatcggatacaaagaagagaaagattgacatggaagaaggt
gaggaagagtttaaatttattgacgaagatgaggatgaataa

DBGET integrated database retrieval system