KEGG   Naegleria gruberi: NAEGRDRAFT_73195Help
Entry
NAEGRDRAFT_73195  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ngr  Naegleria gruberi
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NAEGRDRAFT_73195
Messenger RNA biogenesis [BR:ngr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     NAEGRDRAFT_73195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 3330 aa AA seqDB search
MIAFGPDNENSFHTLYERVSSLSLIKENKDSTTKFFQLLANFKSSFQFKFPEKSSDARNK
IQTNNVDIKGVPSTLPDSLKELVLQVSDALNLNELVALSLIFTATKSNPPQVYGVHEYQL
SIKLFYEDYLKLLSSVLILFQSRFNEDLHPNTRDVVVKFTNELLSDNIISSICEQITSTS
KQINEAQNLITTLEQQGNQDSVKVYQSSEQIKYKVEIRRGFAECLFFACSNIQCDDDTFF
KVFNTFIGLQNLFNQCVANRIGERQEEFSYSFPSIFEYLPIGTKSIFSILYLLTTTILSL
LDPTIGKIRIDPKGVTQSPNNSLYKQQFIEKFDKILDNLMPDDHDDLSYLIDRTQFEAMT
ALQWCVGLRVQNNIKPNLELLTRSDNAFSKSLSRGVFAFITTGLLNNKVYRSESENVKEF
IVNILGDLISSFIVNLEDSINDSLVDQIEELRSYLTRRDDNQASEEDEQNIPREFNDILL
LLAELYRGFPSYTHKYFDRDANPKLNDFLRKTCCEQITSLCKFQVELDVTFIYYLGVLCS
FSGDSVGATNVFALLNDSTYPLFSWEYFFKVLLEEFRSQCSSNDDFVFEKRTLDAISIVL
KLVEVVCRNSEQSRVAILDNTNWRVLGLLFEMMYAPKITPCLMGQVFSTLSSFLKPSQGE
PSNIAFAIISQMGRILHYEIRDQKYEVSSKGGIKYQLNFREAQEGEYYETLGFLELIDAL
ISSTGMAIVGFTPFLKFIQEDVFNNFSKRYYKDQSDKWLIAKSCLQIFTKLLSRYTPSTS
DFEEVKSSEDETPKVNDPPAGFQLMRDMLSDTIFRKELFKIVIGEDFNLEEERYNNREGE
ALERSVIYALEIIETTLLKEDDFIKCSTSKLHLVPLVIKRLEYQLPNSLIIRLIDLIDYS
HNNEIRYRVVNILCLISKNATKLVSLFKDKRKEKTVVKLFVKYLHAVTTETNRECSDVEE
IPVTEEQRDNETRLRMLDLLKANLDAPGENLSHLLCGFDVSNDEPREIDIFNEKTCLTVI
LNLLKSKQLPITHPRFIESCYELIYKLCADRRVSQQTFACLEKANFLIDKLKNANFSTKI
EPSPLAHHILNQRGFVIRIVALKLYSNTKAFKKGDSNRGGVQELVHILFGGDSLSDFSRS
YDLLEQRRALMLEILDTIDLNLAQNAPAQDSKEWKLFLKNWASTSNSFDGWKQVVEITLS
QCFGMIPDDGMRLRILHDIISSLLFKLFQMKRINKGKQQQKLELLVSQVILRVMSKLREE
FITSGEVIMLPVDQCLTIFRNLLECILLSEQSEQSIRGNLYSTLINYLQYTKRNELNYGS
DQIMNLQKNTEHIIDKYDLRVFALVAKDALDAKNIWKAVSYSLLETFFTYTTNIAQRGKW
ITYFESSGCLKQILDSVMTEAKHSLPKVLQPTLHDTDASSLNRLFIYENAMSFLLKFTDV
DVKSAEIMMSFEVITKICSHFTFIDLRPSIVSHQYGRKMDMEDDMEADWEPSITEKYNQL
VIPAIKLIVAIQSHMRINKKVAEQVLSFVELHRKSISAILKMENIQKNLINIDSGSLELV
RLVTEMMYLLSLHQDVMSSKLHTNKYEKLMLNALVKLNTIQQLGSTKKTINILDANMADE
NGIRTGELQFEYSLEQKRCCIDEILCQYPEFLTSGSSLELIGKVLFTHFISGPNSASGKQ
MALDEDIIPKPFELDQRPSIHVLGLLLQNGYHRLNNALEERFTCESNLQQLDQLKIEQLN
NIVRSANTILGEEHFLSFFEKQDSVPNEAKLLCRTILSRKLLKLDIHLNTHISLLENTLI
VLFRHISFYVQNRESPLSAEQRTQLLQEATTGTLNKLLDEILQMQIPKSLLQRYSTVDNI
FHLTIAQRLKNLIFQVFGSYHCQLLVLLAFCMCFVQSTNIYQSSSSNSSIYYNNLATYSV
QTIIGYPRPLQNYFPSGLPATYYWGLSIQAIVLPRNGDGSLHGDEIIYISSMEIIYKYSK
QDGLLRKLSFSGEKWYDISSFFVLKTQEGGTLIYVTSNRLESTVYSASEESGTVQRIAGS
LSSSGYNGDGKPAIDSLLSQPQSVFVKDGEVYICDTNNHLIRRIDRNGILWNVFQKGFVR
EPQQLIFAGNDMVVNTGNLILRIFPNQTYETHYAFYSFSKAAVFENDIYYINYGSIQKAI
GSYSSETVLVFEKSAKIPRILTINNEGNYLVSVGNVLKEFQRYNDSIGRVVIGTSDSNLQ
YYTLPANISDIQNVESMTLCEEDNSIIFTQHSSSVIRHYVPNKPFMDVVGMNVDKISFIS
KYGNDMYAIVNNNIYLRNNQGNFTQLSGLLSPVNVPDNIKATLSTLNNPRGIFLKNQKLY
ISDSNNHRIRVIDIQTGLISTLAGNGIANFSGDGLAATEASLNSPSGVFVSEFGKIYISD
SGNHRIRAILPNGIISTVGGNGIPGFSGDNGLATNASLNNPYGIVETYSGDLIISDSDNN
RIRLIDRYGIITTLAGTGEKGFQDGFFLDALFNNPSQLFYFHSRLYISDTYGQRIREANL
ESKTVKTIIGTGEKGYNGDNFPTTTQLNNPLSMFITYNNIIYIADTDNKKIRMLNTGIVS
TLELTFESPKGITGDDKFLYITDGNLVKKIDIANGYRVEIIGGGIGDGWYLKYAILNAEN
LAFDDEKNVYFTDSSHNVVRKFNTMNGIVSTVAGRTSTLGYEGDGGLAVGALLNFPKGIA
VSKSSLGFFLYICDFENQRIRRVNLETGIITTVVGTGQKGYSGDGGLAIYAKITNPTHIA
VNKEGEVFFSDYNYVRKITRNGYVYRISGAQGGTDFNGDSYPALETGFSITKTLMVDNTG
SIVVFDYNNQIIRKLIPHCETGYSLEPETNSTCIPNCFGIYGKTINACSSHGFCKSLDQC
ECYSGYSGSNCSESICFGKTGSGACNGKGICVSPNVCQCLDDYSGIDCSIPKTVLILVGS
LIACGLVIVIVFVISVSMVFVYIQNQRKKRAILMTDKLLDKRLLMDDFASYNSSMGISNS
ELNEADFVIPLEQLDMDHPIKRIGEGSFGRVFSTKWGNQLVAVKVVDMNDFDMSEETFKQ
EFQILSRLRHPKIVSFYGISFSPTKRYIVMELCEHSLEHVISQLQNQVIQMDLQEKIDIL
IDIIEGVNYLHTLTPKCLHRDLKPLNILVSFQKEYKLCDFGVGKILNSKTVNSLTNNVGT
CYYMAPETTGCESLQESESVCATSIDIYSLAIIFYQLLFEVKEPYISCHDRVLKKLKMNE
PLQLTNMYHLHRLVIEKNLRPIIPFSSAKECQQWCQEYLSPTDAKYHSIFYEICQLTKLC
WDKQPKTRPSAKTILERLHGWKKEIETKYY
NT seq 9993 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctttggacctgataacgaaaattcttttcatacactctacgaacgagtttca
agcctaagtttaattaaagaaaacaaggatagtacaacaaaattctttcaactccttgct
aatttcaaatcaagttttcaattcaagtttccagaaaaatcatcagatgccagaaacaaa
attcaaactaataatgtagatattaaaggagtgccttcaacattaccggattcacttaag
gaattggttctccaagtgtccgatgctcttaatcttaacgagttggttgctctcagcttg
atttttacagcaacaaaaagtaatccaccacaagtttatggagtacatgaatatcaatta
tctatcaaacttttttacgaggactatttaaaattgttatcatcagtattgattttattc
caatctagatttaatgaagatttacatcctaataccagagatgttgttgttaaatttact
aatgaattgttgagtgataatattatttcatcaatttgtgaacaaataacatccacatca
aaacaaattaacgaagctcaaaatttaattactacattggaacaacaaggtaatcaagat
tccgtaaaagtatatcaatcaagtgaacaaatcaagtacaaagtcgaaataagaagaggc
tttgctgaatgtttgttctttgcttgttcaaatatacaatgtgatgacgatacattcttc
aaagtatttaacacattcattggattacaaaatttgtttaatcaatgtgtagctaacaga
attggagaaagacaagaggagttctcatatagcttcccatctatttttgaatatcttcca
ataggtacaaagagtatctttagcatattgtacttattaacaacaacaattctttcttta
ttggatccaacaatcggaaagattagaattgatcctaagggtgttacacaaagtccaaac
aacagcttatacaaacaacaattcatagagaaattcgacaaaattttggacaatttaatg
cctgatgatcatgatgatttgagctatttaatagatagaactcaatttgaagccatgact
gctttacagtggtgtgttggtttaagagttcaaaataatatcaaaccaaatcttgaatta
ttaacaagaagtgataatgctttctctaagagtttatcgcgaggagtttttgcattcatc
acaactggacttttgaataacaaggtttacagaagtgaaagtgaaaatgtcaaagaattt
attgtcaacatactaggtgacttgatatccagttttattgtaaatttggaagatagtatt
aatgattcattggttgatcaaattgaagaattgagaagttatttaacaagaagagatgac
aatcaagcatctgaagaagatgagcaaaatattccaagagaatttaatgatattttactg
ttattggctgaattatatcgtggattcccaagttatactcacaaatactttgatagagat
gctaatccaaaattgaacgattttttgagaaagacatgctgtgaacaaattacttccctt
tgcaaatttcaagtagaacttgacgtaacattcatttattatttgggagtactttgttca
ttcagtggagattctgtgggagcaacgaatgtttttgctcttttgaatgactctacttat
ccactttttagctgggaatatttctttaaagtattacttgaagaattccgttcacaatgt
tcaagtaatgatgattttgtttttgagaagagaactcttgatgcaatttcgattgttctt
aagcttgtagaagttgtatgtagaaactctgaacagagcagagttgcaattttggacaat
acaaactggcgtgtgttaggtttgctttttgaaatgatgtatgcaccaaaaattacacca
tgtttgatgggtcaagttttctccaccttgtcatcattcttgaaaccatcccaaggtgaa
ccaagcaacattgcttttgctattatttcacaaatgggtagaattctccattatgaaatt
agagatcaaaaatacgaagtctcaagcaagggaggtattaagtatcaattgaattttaga
gaagctcaagaaggagaatactatgaaactttaggattcttagaacttattgacgctctt
atttctagcactggaatggctattgttgggttcacacccttcctcaagtttatccaagaa
gatgtttttaataatttctcaaaaagatattataaggaccaaagtgataagtggctgatt
gcaaagtcttgtctacaaatatttacaaaacttctttccagatacaccccatctacttct
gattttgaggaagttaaatcatccgaagacgaaacaccaaaagtcaatgaccctccagct
ggattccaacttatgagagatatgcttagtgatactattttcagaaaagaattatttaaa
attgttataggagaagattttaatcttgaagaagaaagatataacaatagagaaggagaa
gctttggaaagatcagttatttatgctttggaaatcattgaaactaccttactcaaagaa
gatgatttcattaaatgttctacaagcaagcttcatttggttccattagtgatcaaacgt
ttagagtaccaattacctaattcattaataattagattgattgatcttattgattattca
cataacaatgaaatcagatatagagttgttaatatcctttgtttgattagcaagaatgct
actaagttggtaagcttgttcaaggacaagcgtaaggaaaagaccgtggttaagcttttc
gtcaagtatctccatgctgtaacaactgaaacaaacagagaatgctctgatgttgaagaa
attcctgtaacagaagagcaaagagataatgaaactagattaagaatgttagaccttttg
aaggctaatcttgatgctcctggagaaaacttgagccatttattatgtggatttgatgtt
tctaatgacgaaccaagagaaatcgacattttcaatgaaaagacttgtctcacagtaatt
cttaacttgttgaaatctaaacaattaccaattactcatccaagatttattgaatcatgt
tatgaacttatttacaagttgtgtgctgatagaagagttagtcaacaaacatttgcttgc
cttgaaaaggccaactttttgattgataagttgaagaatgctaacttctccacaaagatt
gaaccgtcacctcttgcccatcatattctcaaccaaagaggttttgttattagaattgtt
gctctcaaattatactctaacacaaaggcattcaagaagggtgatagtaacagaggaggt
gttcaagaattggtacacattctttttggtggtgactcactttctgatttcagtcgttct
tacgatttacttgagcaaagaagagccctcatgctcgaaattttggacactatcgacttg
aacttggctcaaaatgctcctgcacaagattcaaaggagtggaaacttttcttgaagaat
tgggcatcaacttctaactcattcgatggatggaaacaagtagtagaaattactttgtcc
caatgttttggtatgattccggatgatggaatgagactgagaatattgcacgatattatt
agttcattgcttttcaaacttttccaaatgaagagaattaacaaaggtaaacaacaacaa
aaattggaacttttggtttctcaagtaattttgagagtcatgtccaagttaagagaggaa
ttcattactagtggtgaagtcatcatgcttccagttgatcaatgcctcacaattttcaga
aatttacttgaatgcattttactttctgaacaaagtgaacaatccataagaggtaatctt
tactctacacttatcaactatttgcaatacaccaagagaaacgagcttaactatggaagt
gatcaaataatgaatcttcaaaagaatactgaacacattattgacaagtatgacttgaga
gttttcgcccttgtagctaaggatgcattggatgctaagaacatttggaaggctgtttct
tactcccttttggaaactttcttcacatacaccactaacattgcccaaagaggtaaatgg
atcacttactttgagtcaagtggatgtttgaaacaaattttggatagtgttatgacagaa
gccaaacattccttgcctaaggtgttacaaccaacccttcacgatactgatgcctcttct
ttaaacagacttttcatttatgaaaatgctatgtcattccttctcaagtttactgatgtt
gatgttaagagtgctgaaattatgatgagctttgaagttattaccaagatttgctcgcat
ttcacctttatcgatttgagaccttcaattgtttctcatcaatatggcagaaagatggat
atggaagatgatatggaagctgactgggagccttctatcactgaaaaatataatcaactt
gttattcctgcaattaagctcattgtcgccattcaatcacatatgagaattaataagaag
gttgctgaacaagtcttgtcatttgttgagctacacagaaagtcaatttctgcaattctt
aagatggaaaatattcaaaagaatttgattaatattgattcgggttctttggaattggtt
cgtttggttacagagatgatgtatcttttgtctcttcatcaagacgttatgtcttctaaa
ttacatactaataagtatgaaaagttaatgttgaacgcgttggttaaactgaatactatt
caacaattgggatctacgaagaagactatcaatattcttgatgccaacatggctgatgaa
aatggtatcagaactggagagctgcaattcgagtatagtttggaacaaaagagatgttgt
attgacgaaattttatgtcaatacccagaattcttaactagtggatcaagtttggaactg
ataggaaaagttctatttacccattttatttctggaccaaattcagcttcaggtaaacaa
atggccttggatgaagatattattccaaagccattcgagcttgaccaaagaccatctatt
catgtacttggtttgttgttgcaaaatggataccatagattgaacaatgctctcgaggaa
agatttacttgtgaatccaacttgcaacaattggatcaattgaagattgaacaattgaat
aatattgttcgttcagcaaacacaattttaggagaagaacatttcttaagcttctttgaa
aaacaagacagtgttccaaatgaagccaagttgctttgccgaacaattctttccagaaaa
ttacttaaacttgatatccacctcaacactcacatcagtttgttagaaaatactttgatt
gttttattcagacacatcagtttctatgtacaaaatagagaatctccattatctgctgag
caaagaacacaactcttacaagaagcaacaactggaacactcaacaagttgttggatgaa
attctccaaatgcaaattccaaaatctttacttcaaagatattccacagttgacaatatt
ttccatttgactattgctcaacgtcttaaaaacctaattttccaagtatttggtagttac
cattgccaacttttagttttgttggctttttgcatgtgttttgtgcaatcaacaaatatt
tatcaatcatcttcatcaaattcctctatttattataataatttggccacctatagtgtt
caaacaattattggatatccgaggccattgcaaaattactttccgagtggtttgccagcc
acttactattggggattatcaatacaggcaattgtattgccacgaaatggtgatggaagt
ttacatggtgatgaaattatttacatctcctccatggaaataatttacaaatattcaaaa
caagatggactattgagaaagttatcatttagtggtgagaaatggtatgatatttcatca
ttctttgttttgaaaactcaggaaggaggaactttaatatatgttacttccaatagactc
gagtcgactgtttattcggcaagtgaagaaagtggaactgttcagaggattgcaggttct
ttgagttcatcgggatataatggtgatggaaaaccagctatcgattccttactgagccaa
cctcaatctgtatttgttaaggatggtgaggtttatatttgtgatacaaataatcatctg
attcgacgtattgataggaatggaattttatggaatgtttttcaaaaagggtttgtaagg
gaaccacaacaactaatttttgcagggaatgatatggtagtaaacacaggcaatttgatt
cttagaatatttcccaatcaaacatatgaaactcattatgctttctattcattttctaaa
gctgctgtttttgaaaatgatatctactatatcaattatggtagtatccagaaggcaatt
ggttcatattcctctgagactgtgttagtgtttgaaaaatctgccaaaattcctagaatt
ctaacaatcaacaatgagggaaattatttagtttcagttggaaacgttttaaaagaattt
cagagatataatgatagtattggaagagttgtgattggaacatcggattctaatcttcaa
tactatacattaccagcaaatatctcagatattcaaaacgttgaatcgatgacactttgt
gaagaggacaattccattattttcactcaacattcgtcttctgttataagacattatgtt
ccaaacaaaccattcatggatgttgttggaatgaatgtggataagatatcttttatttca
aagtatgggaatgatatgtatgcaattgtgaataataatatttacttgaggaataaccaa
ggaaatttcactcaattatcaggattgctatcaccagtcaatgtacctgataatattaag
gcaacattatcaaccttaaacaatcctagaggaatatttcttaaaaaccaaaaactgtac
atttctgattcgaataatcatagaatacgagtaattgatatacaaactggacttatttct
acattggcaggaaatggaattgcaaattttagtggtgatgggctagccgcaacagaagca
tccctaaactctccatctggtgtatttgtttcagagtttggaaaaatttatatatctgac
tctggtaatcatagaattagagctattcttccaaatggcattatttcaactgttggaggt
aatggtattcctggattttcgggtgataatggtttggctactaatgcaagtcttaacaac
ccctatggcatagttgaaacatatagtggtgacttgattatttctgattctgataacaat
agaattagactaatcgatagatatggaattatcacaactctagctggaacaggagagaaa
ggattccaggatggattctttctcgacgcgttatttaacaatccatctcaattattttac
ttccattcccgcttgtacatttcagatacatatggccaaaggattcgtgaagcaaatctt
gaatcaaaaaccgtaaaaacaattattggaacaggagagaagggatacaatggagataat
ttcccaaccaccactcagctcaataaccctctatcaatgtttattacatataataatatt
atttacattgcagatactgacaacaagaaaataagaatgttgaatacgggtattgtatca
acactagagcttacttttgaatctccaaagggaataactggagatgataaatttctctat
atcaccgatgggaatttagttaagaaaattgatattgccaatggttatagagttgaaatt
attggaggtggaattggtgatggttggtacttgaagtatgcaattcttaatgctgaaaac
cttgcttttgatgatgagaagaatgtttattttacagattcttctcataatgttgtaaga
aagttcaatacaatgaatggaatagtgagtacagtagcaggaaggactagtacattggga
tatgaaggtgatggtggattggctgttggggctctcttaaattttccaaaaggtattgca
gtttccaagtcgagtttaggattctttctctatatttgtgactttgaaaatcaacgcatt
cgaagagttaatttggaaactggaataataacaacagtagtaggtacaggtcaaaaagga
tatagtggtgatggagggttagcaatttatgccaagattactaatccaacacatatagct
gtcaacaaggaaggagaagttttcttctcagattacaattatgtaaggaaaataacaaga
aatggatatgtttatagaatatctggtgctcaaggaggaactgattttaatggagattca
tatcctgctttggaaacaggtttcagtattacaaaaactttaatggtagataatactgga
agtattgttgttttcgattataacaatcaaattattagaaagttaattcctcactgtgaa
actggctatagtttggaacctgaaactaattctacatgcattccaaattgttttggaatt
tatggaaaaacaattaatgcttgttcttcacatggattttgtaaaagtttagatcaatgt
gaatgttattctggttattctggatcaaattgctcagaatcaatatgctttggtaagacg
ggatctggagcatgtaatggcaaaggaatttgtgtttcaccaaatgtttgtcagtgcttg
gatgattattcaggtattgattgttcgatacctaaaacagttttaattttagttggaagt
ttgattgcttgtggcttggttattgtaatagtttttgtaatttctgtttcaatggtcttt
gtctatattcaaaatcaaagaaagaagagagcaatcctcatgactgacaaattattagac
aagagattgcttatggatgattttgcatcctataattcttcaatggggatcagtaatagt
gaactcaatgaagcagattttgttattccactggaacagttggatatggatcatccaatc
aagaggattggtgaaggttcttttggaagagtattttctacaaaatggggaaaccaatta
gttgccgttaaggttgtggacatgaatgattttgacatgtcggaggaaactttcaaacaa
gaatttcaaatcttgtcacgtttaagacatccaaaaattgtctccttctatggcatttca
ttttctccaacgaagagatatattgttatggagctttgtgaacacagcttggaacatgtc
attagtcaattgcagaatcaagttattcaaatggatttacaggaaaagattgatattcta
atagatattattgagggagtgaattatttacataccttgactccaaaatgccttcataga
gatttgaaacccctcaatattcttgtgagctttcagaaagaatacaaattatgcgatttt
ggtgttggaaagattttaaactcaaaaactgtcaattctttgaccaacaatgtggggacg
tgttactatatggctccagaaactacaggatgtgaaagtttacaagaatctgaatcagtt
tgtgctacttcaatagatatttacagtctggccattattttctaccaattattatttgaa
gtgaaagagccctatatttcatgtcatgatagagttttgaaaaagttgaaaatgaatgaa
ccactacaattgactaacatgtaccatttgcatagattagtgattgagaaaaacctcaga
cctatcattccattttcttctgcaaaggaatgtcaacaatggtgtcaggaatatctatca
ccaacagatgccaaatatcatagcattttctatgagatttgtcaattaactaaactatgt
tgggataaacaaccaaaaacgagaccaagtgcaaaaactattttagaacgactccatggt
tggaagaaagaaattgaaacaaagtattactaa

DBGET integrated database retrieval system