KEGG   Naegleria gruberi: NAEGRDRAFT_73398Help
Entry
NAEGRDRAFT_73398  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.4.19.12]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NAEGRDRAFT_73398
Peptidases [BR:ngr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NAEGRDRAFT_73398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 2453 aa AA seqDB search
MSSEENQELHQQATTTTTATEETIPSSVNDIPSSLNVAACDEGREKEEEDQISDKDNNNE
KTQPILEEENTEKDTSTVGETSPLDHEDENSENNFVDENLTNKTDDHQHDHLGSVQQNGI
VKEEEDKKEEKIVKPDLTPNPEDLLTFENGFIEKYKKISDVYKERLARHSNMQELLDLID
CEIKMLDFIRDQYATEFDEYNITNFKSANAIWFLQTHMVSILNHTTSLHMIEDNDLLSKI
GDLINAAIRDYIYIKITYPFDLFQKIMESQAEQKSEKTEKSSESLELEESKSSSQLSEKE
KQSQIVQKINLISKSLVLGVDVCRSLTFQKHEIYSKNLVFARDNKMATNEYNHYMELIQK
HPQSTWNEDFANCIVSTPKPKGENILSKLCCKSINIFAQNGGYYLFNELLKKYKDLPIRV
IEKIIDTISYQLAFLDQKTKETFVPEIINSMFIYIDSLSDEMLKIEEKFKDLLSVFRTKI
ISLYYNDEKSLEFYDRLKLQYFYRLLHCHSVERKMLGMNEIRSHVDTLIKADQMSKQGGS
SPQLNGSNDSNMSSVNISKKDLHIRIFIAWSSEKKLLGYLFETDVHRELVRQSLSILKLL
AQHKGFSREELDLLWNASVDKHEATERLILSTLAGFVPLLSLNDILYLYSKIEAIPVETI
SKRDHMVDFLSHFTICAVNSFSKLKEKKKNWFALDLLWKLAIGGNRKAFECLSELFKQDC
FESIRKTYLLNCIDMLKSRHNTSGTVSLMKTLLATYSLQKRKKKQSTWGVIASINEKTNL
MDHFFTNFEIQFPSDMENTSQTDQELRDQLDFLEFVIRNSPITLSVKNCIVLWTHGNRDI
VMEWMAKMRENYCEDFTSFDDETTRFVFEELVCSLIGENENIIIIEQPNSGKKFISKIIT
KGKELLEPPVPSQEMEEDPVPVVKKIKKIDVLSDDLIGLVHFWNLILSVKDQKVLRQAIE
CLNNYKTGYAKELKHFIADYREKFIAKCMELLKQYSSPSKRKDAYICNIISLMIDYIVVA
NQKSGGGGYKGHGISFLGYPITLKISCYTNESFVKSVSSKMKIYELTNIIASELGDESSA
HLLRLETEKGEDLSCYKHKTLEDLGLESSAEIYVRPISSRDITFSLTSNALKALGVPELG
NVFLSRNRSSAKKSKKQEGGFLASSTHNDDGLDEEYVILNLEDGLNPASILSKESHFSLL
FSLLDGSSSDEVAKKVWMLLMHLPTNYAMSKNILNIENMQGNINWMEILPTNSTHKLLYC
LQILDSKFSKNFVPGSKMYDNFVKYGGLKHLVDGLLCIGKSYKNPLQKQCAALLLKILNK
FIPENNERLNEILLNLLETLRVLIVEETEKRVNNSNLSDSSTTHRPTTSFQYNPQFTTTS
EYAHFMLYDFALTTILKITSSKPDLLQLLLTHETTLSTTKSLLFSPDANIRKKFANTILE
LSSSSSQASSYFITTLYNIMMTEDIDLYKDRCDDYFLLLENSIMNSKHFTEISQEEVFTI
VKKIFDRPIIEENNTSAADQVLIGYFNIAKALIRTYPFLKQELHKHIKDLFLNGLFEVPK
LTDQTDNLPLPKCKTKESRSATFNFLQEVVDGCPDNYLEILQLLEEYIRGCEQPQNWQVY
PIYQEKKKPFVGLKNQGATCYMNSLLQQFFMTIPFRKELITVNTDELPTNEKLQENVSLL
REVQDMFAFLEYGRKKFYDTRPFCRVYKVDGRPVECSTQHDANEFFNLFMDCVEEALKFY
KKDYLLRDVYGGSLLHQIIYEENISERPENFNIISLEVKNKRNIMESLELYCQGEMLEGN
NQYFSDKLDRHVDALKRTLIKDLPNVLILHLKRFDFDFSLMVNRKINDRVEFPHLLNMEP
YTVEGMERKENRGIYDIPPPHRPDDYYQYKLVGVLVHSGSADSGHYYSFIMDRKNEEEKW
YEFNDEEINPFDLNRMEMECFGGLVEHNISGKKTSLFRCNNAYMLFYQRVSVLNAESFET
KETSAIQPASSVMTQVWKENEKFYHYKNIFDESFDSYLFGNLSTYQSNDYAMVLRNVQLS
CNYIFGYYIRSYNPKIVKWITYLKDTFEKHSRIAKWFLVEFARTDKWKIDSLLICPSQEI
RDSVVDLIIATLRSLYPVENLFEYFEKEEWRFTTTKTMNNYPNFDEPMEVTEKDYECSSG
FFIDCMIDMLSIVPQFHKSTAHYFRLLEDIVSLGPISYRLLCVKRQLVSKLALILGGLLP
KHQNEGEPIYFNFNPKYSIVTTFGQLSVAFIIRIFSILVRTCSASTTARPPTIMDTDQED
SITGVIVSSGPLINPNPRTEPYAYSLCSSDKDKLFHRLFFNHLVNMNIRLQDISAMLCHW
CWDSISISKKFCELFIQSIIVNSATESSDSYFLVFDSLLTIEDSLQSERVGFCLDQYFDS
LSRMTDNNSLLYCMKHLAKIDRMNAYTKSWWDNNFKSIETITSKKGWTIERKQ
NT seq 7362 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcggaggagaatcaggaactccatcaacaagcaacgacaacaacaacagcaaca
gaggaaacaataccttcttctgtaaatgacataccttcttcattgaatgttgctgcttgt
gatgaaggaagggaaaaagaagaagaggatcaaatatcggataaagacaataataatgaa
aaaacacaaccaatattggaggaagagaatactgaaaaagatactagtactgtaggagaa
acaagtccattggatcacgaagatgaaaattctgaaaataattttgttgatgaaaatttg
acaaacaaaactgatgatcatcaacatgatcatcttggttctgtacaacaaaatggtatt
gttaaagaggaagaagacaaaaaggaagagaaaattgtcaagcctgatttgactccgaat
ccagaagatttactaacatttgaaaatggttttattgaaaagtataagaaaattagtgat
gtttataaagaaaggctagcccgacattcaaacatgcaagaattgcttgatttaattgat
tgtgagattaaaatgttagatttcatcagagatcaatatgccacagagtttgacgagtac
aatattacaaactttaaaagtgctaatgcaatttggtttcttcaaacacatatggtttct
attttaaatcacacaacatcacttcatatgattgaagataatgatttactttcaaaaatt
ggagatttgattaatgctgcgattcgtgattatatttatatcaaaataacctatcctttc
gatctatttcaaaagataatggaaagtcaagcagaacaaaagtcagaaaagactgaaaag
agttctgaatctcttgaattggaagaatctaaatcctcatcccaactcagcgaaaaggag
aagcaatcacaaatagttcaaaaaattaatctcatatcaaaatcacttgttcttggagtt
gatgtttgtagatcactaaccttccaaaaacatgaaatttattcaaaaaatcttgtgttt
gcaagagacaacaaaatggcaacaaatgagtataatcactatatggaattaattcaaaag
catccacaaagtacatggaatgaagattttgcaaactgtattgtctccactccaaaacca
aaaggagaaaatattctttccaaattatgttgcaagtcaattaacatttttgcccaaaac
ggaggttattatttatttaatgaacttttgaaaaaatacaaagatttaccaataagagta
atagaaaagattattgatacaatttcctatcaattagcatttcttgatcaaaaaacaaaa
gaaacttttgtacctgaaattatcaactcaatgtttatttatatagattctctttcggat
gaaatgttgaaaatagaagagaaattcaaagatttactatcagttttcagaacaaaaatc
atctcattatattataacgatgagaagagtttagaattttatgacagattgaaattgcaa
tatttttataggttattgcattgtcactcagttgaaagaaaaatgttgggaatgaacgaa
attagatctcatgtagacactcttatcaaggctgaccaaatgtcaaaacagggaggatct
agtccacagttaaatggatctaatgattctaatatgtcatctgtaaatatatcaaagaaa
gatttacatattagaatttttatagcatggtcgagtgaaaagaaattactaggttattta
tttgaaactgatgtacatagagagcttgtaagacaatctttatcaatacttaaattatta
gcccaacataaagggttctcgagagaggaacttgacttgttgtggaatgcctctgttgac
aagcacgaggcaacagaaagattaattctttctactctcgctggttttgtaccattactt
tcccttaatgatattctttatttatattcaaaaattgaagctattccagttgaaacaatc
agcaaaagagatcacatggtagatttcctttctcattttactatttgtgctgttaattca
ttttcaaagttaaaagaaaagaaaaagaactggtttgctctcgatttactttggaaacta
gctattggcggaaatagaaaagcatttgaatgtctttcagaattattcaaacaagattgt
tttgagagtattagaaagacatacctgttaaactgtatcgatatgctcaagtcaagacac
aatacatcaggaaccgtatctcttatgaagacattgttagctacatactcccttcaaaag
agaaagaaaaaacaatcaacatggggtgtaatagcatctattaacgaaaaaacaaatctt
atggatcacttttttacaaactttgaaatccaatttccaagtgacatggaaaataccagt
cagacagaccaagaactgagggatcaattagactttttggagtttgttattagaaactct
cctattaccctttctgttaaaaattgtattgttttatggactcatggtaacagggacatt
gttatggaatggatggcaaagatgagagaaaattattgtgaagattttacctcttttgat
gatgaaacaactagatttgtatttgaagagttagtttgttcgctgattggagaaaatgaa
aacatcattatcattgaacaaccaaactcaggaaagaagtttatttctaaaatcatcaca
aaaggaaaagaacttcttgagcctcctgttccatcacaagagatggaggaggatcctgtt
cctgttgtaaagaaaattaagaaaatagatgtgttatcagatgatttaattggtttagta
cacttttggaatttaattttatctgtgaaagatcaaaaggtgttaagacaggcaatagaa
tgcttgaacaattacaagacaggttatgcaaaagagttgaaacattttatagctgactat
agagaaaagttcattgcaaaatgtatggaacttcttaaacagtacagtagtccatctaag
agaaaagacgcctacatttgtaacatcattagtcttatgattgattatattgtagtagca
aatcaaaagagtggtggaggaggatataaaggccacggaattagtttccttggatatcca
atcactttgaagattagttgctacacaaatgaaagttttgtcaaatcggtttcttcaaag
atgaaaatatatgaattgacaaatattattgcctctgaactcggtgatgaatcttcggcc
catttattaagattggaaactgagaaaggtgaagatttatcatgttacaaacacaaaaca
ctggaagatcttggtttagaatcaagtgctgaaatttatgtcagaccaatttcatcaaga
gatatcacattctccctaacgagtaatgctttgaaagctcttggagttcctgaacttggt
aatgttttcctctctagaaatagatcttcagcaaagaaaagtaagaagcaagaaggagga
tttttagcatcttctactcataacgatgatggtcttgatgaggaatatgtgatattgaac
ttggaggatggattgaaccctgcgagcattctatcaaaagaaagccatttctcgctattg
ttctctcttcttgacggttcaagcagtgatgaggtagccaaaaaggtttggatgttacta
atgcatttacctacaaattatgcaatgtccaaaaacatcttaaatattgaaaacatgcaa
ggtaatattaattggatggaaattttaccaactaacagtacccacaagctattatattgt
ttacaaattcttgattcaaagttttccaaaaatttcgttcctggatcgaagatgtatgac
aactttgtgaaatatggaggtttgaagcatcttgtggatggattgttatgtattggaaag
agttataagaatcctctccagaaacaatgtgctgctttactattgaagatcttgaataag
tttattccagaaaataatgagagattgaatgaaattttactcaatttacttgaaacttta
agagtattaatagtagaggaaacagaaaaaagggtgaataactctaatctttctgattca
tctaccacacacagacctactacctctttccaatataatcctcaatttactacaacctcg
gagtatgcccactttatgctttacgactttgccttaactaccattcttaaaataacatca
tccaaaccagatttattacaactactgctcactcatgaaacaacattgagcactacaaag
agtctcctattctctcctgatgccaatattagaaagaagttcgccaatacaattttggaa
ttatcttcttcctctagtcaagcttcaagttattttattacaacactctataatataatg
atgactgaggacattgatttgtacaaggatagatgcgatgattatttccttttattggaa
aattctattatgaactctaaacattttacagagatttcacaagaggaggtgtttaccata
gttaaaaagatatttgatagaccaattattgaggagaataatacctctgctgcagatcaa
gttttgattggttactttaatattgcaaaggctctcataagaacttatccattccttaag
caagaattacacaagcatatcaaggatttgtttttgaatggtttgtttgaggtaccaaaa
ttaactgatcaaacagataatttgcctttaccaaaatgtaaaacaaaagaaagtaggagt
gcaacattcaattttttacaagaagttgttgatggttgtcctgataattacttggaaatt
ttacagttattagaagaatatattcgaggttgtgaacaaccacaaaattggcaagtctac
ccaatctaccaagaaaagaagaaaccattcgtaggattgaaaaatcaaggagccacatgt
tatatgaactctttacttcaacaattcttcatgactattcctttcagaaaggagttaatc
actgttaatacggatgaactgcctaccaacgaaaaacttcaagaaaatgtttctttgttg
agagaggtccaggatatgtttgccttcttagagtatggacgtaagaaattctatgataca
cgaccattttgtagggtttacaaagttgatggcagacctgttgaatgctcaactcaacat
gatgccaacgagtttttcaacttatttatggattgtgtagaagaagcattaaagttctac
aagaaggattatctcctgagggatgtttatggaggatctcttctccatcaaattatctat
gaagaaaatatttcagagagaccagaaaatttcaatattatcagtttagaagttaaaaat
aagagaaatattatggaatccctagaattgtactgtcaaggtgaaatgctcgaaggtaat
aatcaatatttcagcgacaagcttgacagacatgtagacgcactcaaaagaactcttatt
aaggatctacctaatgttctgattcttcatttgaaacgatttgattttgatttcagtcta
atggtaaacagaaaaatcaatgatcgtgtggagttcccacatttattaaatatggaaccg
tatacagtagaaggtatggagagaaaggaaaatagaggaatctacgacattccgcctcct
catagacctgacgattactaccaatataaactagttggtgttttggtacactcaggaagt
gctgactctggccactattactcattcataatggatagaaagaatgaagaagagaagtgg
tacgaatttaacgatgaagaaattaatccattcgatcttaacagaatggaaatggaatgt
tttggaggactggtagaacataatatttcaggaaaaaagacatccctattcagatgtaat
aatgcctacatgttattctatcaaagggtgagcgtgcttaatgctgaatcatttgaaaca
aaggaaacttcagctattcaaccagcctcttctgtaatgacccaggtttggaaggaaaat
gaaaaattctatcattacaagaatattttcgatgaatcttttgattcatacttgtttggt
aatttaagtacctaccagagcaatgattatgccatggtgttgagaaacgttcagctatca
tgtaattatatctttggatattatatcagatcttacaatccaaagattgttaagtggatt
acctatttgaaagatacttttgaaaaacatagtagaattgcaaagtggttcctagtagag
tttgctagaacagataaatggaagatagattctctactgatatgtccatcccaagaaata
cgtgattctgttgtggatttaataatagcaactttgagatcactatatccagttgagaat
ctatttgagtattttgaaaaggaggaatggagatttaccactacaaagaccatgaacaat
tatcctaattttgatgagccaatggaagtaacagaaaaagactatgaatgttcttcagga
ttctttattgattgcatgattgatatgttgagcattgttccacaattccacaaatctaca
gctcattatttcagattattggaagatattgtttcacttggtccaatttcttacagattg
ttgtgtgttaagagacaattagtctcaaaacttgctctaattttgggtggactattacca
aaacatcaaaacgaaggcgaaccaatttactttaattttaatccaaaatattctattgtt
acaacttttggacaattatcagttgcttttataattagaattttcagtatcttggttaga
acatgctctgcatctaccacagctagacctccaacaattatggacactgaccaagaggat
tccattactggagtaattgtttcctctggaccactcattaatccaaatccaagaaccgaa
ccgtacgcttatagtctttgttcatcagataaggacaaactattccacagactcttcttc
aatcatttagtcaacatgaatatcagattgcaagatatttcagccatgttatgtcattgg
tgttgggatagtatttctatttccaaaaaattctgcgaattgtttattcaatcaataatt
gttaactcggcaactgaatcctcagactcatacttccttgtattcgattcattgttgact
attgaggattctttacaatcagaaagagtaggattttgcttggatcagtactttgattca
ttgagcagaatgacagataataattcattactttactgcatgaaacatttggcaaagatt
gacaggatgaatgcgtatacaaagtcttggtgggacaataactttaaatctattgaaaca
atcacatcgaaaaagggatggaccattgaaagaaagcaataa

DBGET integrated database retrieval system