KEGG   Naegleria gruberi: NAEGRDRAFT_73722Help
Entry
NAEGRDRAFT_73722  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ngr  Naegleria gruberi
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ngr00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ngr00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 431 aa AA seqDB search
MNDNLVLLNPKDKKQKIIGFGCAMTEASSFVFSTMNEDVKRQILDLYWSPKGLNYTVGRI
PMNSCDFSLGTYSCDDVNGDYDLKYFNINRDKLFKYPLVSRVVNNTRTFNGKPLKLFLSP
WSPPAWMKINNDMNGSSTPIGLINETRILDSWALYYSKYITAYKNLGVPFWGLTVQNEPE
FAAPYEACVYTAEFQRDFIKRHLGPRIKQDHPEVNILIYDHNRDHVHLWAEIIYADKEAS
KYVAGTAFHWYVNGQYEHLTMAHDIAPEKILLGTEATQGPRVAFGDWGRGESYGFDIIND
LENYAQGWTDWNCILDPIGGPTHMQNWCDAAIVANNKTQSIYLQPMYYYMGHFSKYLTEG
SVRIAHENTLDTLLVTSFITPENKMVVIVMNQEQTSQIFKLIDMSIGIDYAAEMVIPPHS
IRTLIYDHRFE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaatgataatcttgtcttgttgaatcctaaagataaaaagcaaaagattattggattt
ggttgtgccatgactgaggcttcatcatttgtcttttcaacaatgaatgaagatgtaaag
agacaaatacttgatttgtattggtcaccaaagggattaaattatactgttggaagaatt
cctatgaattcatgtgatttttcattgggaacttatagttgtgatgatgtgaatggagat
tatgatttgaaatatttcaatattaatagagataaattattcaaatatccattggtttct
agagtggtaaataatactagaacttttaatggaaaaccattgaaattattcctttctcct
tggagtcctcctgcatggatgaaaattaataatgacatgaatggaagttcaacaccaatt
ggattgattaatgaaactagaattttggattcatgggccttatactattcaaaatatatt
actgcttataagaatttaggtgttccattctggggattgactgttcaaaatgaacctgaa
tttgctgccccatatgaagcttgtgtttatactgcggaattccaaagagattttattaag
agacatcttggaccaagaattaagcaggaccatccagaagttaacattttaatatatgac
cacaatagagatcatgttcatttgtgggctgagattatttatgctgataaggaagcatct
aaatatgttgctggaactgcattccactggtatgtcaatggacaatatgaacacttgaca
atggcccatgatattgctcctgaaaagattctgcttggcactgaggcaactcaaggaccc
cgtgttgcttttggagattggggaagaggtgaaagttatggatttgacattattaatgat
ttggaaaattatgctcaaggttggactgattggaattgcattctcgatccaattggtgga
ccaactcatatgcaaaattggtgtgatgctgccattgttgccaacaataagactcaatcc
atctatttgcaaccaatgtattactacatgggtcacttttcaaagtatttgactgaaggt
tctgtaagaattgctcatgaaaataccctcgataccttacttgttaccagctttatcaca
ccagaaaataagatggttgttattgtcatgaatcaagaacaaacaagccaaattttcaaa
ttgattgatatgagtattggcattgattatgctgcagaaatggttattcctcctcactct
attagaactttaatttatgaccatcgatttgagtaa

DBGET integrated database retrieval system