KEGG   Naegleria gruberi: NAEGRDRAFT_74995Help
Entry
NAEGRDRAFT_74995  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
Organism
ngr  Naegleria gruberi
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 Abhydrolase_3 Peptidase_S9 FSH1 Abhydrolase_6 Asp2 DLH Esterase_phd Abhydrolase_1 AXE1 COesterase DUF2974
Motif
Other DBs
NCBI-GeneID: 8856963
NCBI-ProteinID: XP_002669953
JGI: Naegr1_74995
AA seq 305 aa AA seqDB search
MSQLDESLASKWKKFKSFNFEANTQWKEYQENLTFPENLSAEKKQSLLSKYQKKFYLKHV
DPTLKSYEIPYSVSELNGDSHNATMIFLHGFGDQSDGWSQTFDRFLSDEKFKKLKFLVPN
APSQPISLGFGMSFKSWYNVKSLAVEGPDVNEDVPSMEACFEKITQLIDREINEFGVDPS
RIIISGFSQGGSVAFYYGLSCKYKLGGIAILSSWLPLRTQLQSLLQNPEFDFKNCKTPIF
IAHGDADNVLEYKYGVSSKDYLVNQVLNQGGGSEHVEFHTYKGMGHSSNEEELRDLGRFI
GKVLN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacttgacgagtcacttgccagcaagtggaaaaaatttaaatctttcaacttt
gaagcaaacacacaatggaaggaatatcaagaaaatttaacatttccagaaaatctttca
gcagagaagaaacaatccctcctttcgaaatatcaaaagaaattttatctgaaacatgtt
gatccaacgttgaaatcctacgaaattccatattctgtttcagaattgaacggagattct
cataatgcaaccatgatttttctgcatggttttggagatcaatcggatggttggtctcaa
acattcgacagatttctttcggatgaaaaattcaagaaattgaaatttctagttcctaat
gctccttcacaacctatttctcttggatttggaatgagttttaaatcatggtacaatgtc
aaaagtcttgctgttgaaggtccagatgtcaatgaagatgttccaagtatggaagcatgt
tttgaaaagattactcaattaattgatagagaaattaatgaatttggagttgatcctagc
aggattataatttctggattttcccaaggaggaagtgttgcattctattatggattaagt
tgcaaatacaaacttggaggaattgcaatcttatcttcctggcttcctcttcgtacacaa
ttacaatctcttttacaaaatccagaatttgatttcaaaaattgtaaaactccaattttc
atagctcacggagatgctgataatgttctggaatacaaatatggagtttctagtaaggat
tatttggtcaatcaagtgttgaatcaaggaggaggttcagagcatgtggaatttcacact
tataaaggaatgggacattcttccaatgaggaagaattgagagatttaggaaggtttatt
ggaaaggtgttaaattaa

DBGET integrated database retrieval system