KEGG   Naegleria gruberi: NAEGRDRAFT_74995Help
Entry
NAEGRDRAFT_74995  CDS       T01241                                 

Definition
hypothetical protein
Organism
ngr  Naegleria gruberi
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 305 aa AA seqDB search
MSQLDESLASKWKKFKSFNFEANTQWKEYQENLTFPENLSAEKKQSLLSKYQKKFYLKHV
DPTLKSYEIPYSVSELNGDSHNATMIFLHGFGDQSDGWSQTFDRFLSDEKFKKLKFLVPN
APSQPISLGFGMSFKSWYNVKSLAVEGPDVNEDVPSMEACFEKITQLIDREINEFGVDPS
RIIISGFSQGGSVAFYYGLSCKYKLGGIAILSSWLPLRTQLQSLLQNPEFDFKNCKTPIF
IAHGDADNVLEYKYGVSSKDYLVNQVLNQGGGSEHVEFHTYKGMGHSSNEEELRDLGRFI
GKVLN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacttgacgagtcacttgccagcaagtggaaaaaatttaaatctttcaacttt
gaagcaaacacacaatggaaggaatatcaagaaaatttaacatttccagaaaatctttca
gcagagaagaaacaatccctcctttcgaaatatcaaaagaaattttatctgaaacatgtt
gatccaacgttgaaatcctacgaaattccatattctgtttcagaattgaacggagattct
cataatgcaaccatgatttttctgcatggttttggagatcaatcggatggttggtctcaa
acattcgacagatttctttcggatgaaaaattcaagaaattgaaatttctagttcctaat
gctccttcacaacctatttctcttggatttggaatgagttttaaatcatggtacaatgtc
aaaagtcttgctgttgaaggtccagatgtcaatgaagatgttccaagtatggaagcatgt
tttgaaaagattactcaattaattgatagagaaattaatgaatttggagttgatcctagc
aggattataatttctggattttcccaaggaggaagtgttgcattctattatggattaagt
tgcaaatacaaacttggaggaattgcaatcttatcttcctggcttcctcttcgtacacaa
ttacaatctcttttacaaaatccagaatttgatttcaaaaattgtaaaactccaattttc
atagctcacggagatgctgataatgttctggaatacaaatatggagtttctagtaaggat
tatttggtcaatcaagtgttgaatcaaggaggaggttcagagcatgtggaatttcacact
tataaaggaatgggacattcttccaatgaggaagaattgagagatttaggaaggtttatt
ggaaaggtgttaaattaa

DBGET integrated database retrieval system