KEGG   Naegleria gruberi: NAEGRDRAFT_75742Help
Entry
NAEGRDRAFT_75742  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ngr  Naegleria gruberi
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:ngr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 208 aa AA seqDB search
MSSEKKVIDQEEIENDTEAEVNEEVAERPILENTWTLWYHNPQAKLNEQNYSHFYNEVYT
FSDVETFWSVFNHIRGPSEISTGTTYFLLKEGIKPEWEDPKCIGGGEWVYSFPKKHVPAD
QYWLDLVMFCVGESFTYSDNLLGCCVANRKNQIRINLWVDTLDETIAKRFGEQFKFEALK
IGANTNIKIDFKSFKDQLDGKKTVLQVV
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgaaaagaaggtaattgatcaagaagaaattgaaaatgacactgaagccgaa
gttaatgaagaagtagcagaaaggcctattttagaaaatacttggacattatggtatcat
aaccctcaagctaaacttaacgagcaaaactattctcacttttacaatgaagtctataca
ttctcggatgttgaaacattttggagtgtttttaatcacattagaggacctagtgaaata
tcgaccggtacaacttactttttattgaaggaaggtataaaaccagaatgggaagatcca
aaatgtattggtggtggtgaatgggtttatagtttccctaaaaagcacgttccagctgat
caatactggttagatttagtgatgttttgtgtaggagagtcatttacttattcggataat
ttgcttggatgttgtgttgccaacagaaagaatcaaattcgtatcaatttgtgggtagat
acattggatgaaacaatagcaaagagatttggagagcaattcaaatttgaagccttaaaa
ataggagcaaatacaaatatcaaaatagactttaaatctttcaaagatcaattggacggt
aaaaagacagttttacaagtagtgtaa

DBGET integrated database retrieval system