KEGG   Naegleria gruberi: NAEGRDRAFT_75947Help
Entry
NAEGRDRAFT_75947  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ngr  Naegleria gruberi
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NAEGRDRAFT_75947
  Lipid metabolism
   00062 Fatty acid elongation
    NAEGRDRAFT_75947
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     NAEGRDRAFT_75947
Lipid biosynthesis proteins [BR:ngr01004]
 Fatty acid synthase
  Component type
   NAEGRDRAFT_75947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 279 aa AA seqDB search
MRSRETVKFTSPSSLRILTKGGAGNKPFLPILLMHGILCGNNTLKALRDMIKERVPPGTI
VYSIPSEGMVSSVLTPVSAQLEDFRKQINIVKKNFGITDHHLICHSQGGLICRSYLQTTP
DHNVKVFISLSGVQNGEYGVPVGFQFEGFLKQMFPFLFNTALEDVYKIFYTAKDVDYART
LNYRENMLRIDKMVLTGSPQDDIIVPYQSALFEFYQVNSTGGLDMIPMEQQRIYQNDVFG
LKTLNEENRLVRIVVPNVYHVDWLYNPSLVDKCMIPYLY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcacgagaaacagtgaaattcacatcaccatcatcattacgcattctcacaaag
ggaggagctggaaacaaaccatttcttccaatcttgttaatgcacggaattttatgtgga
aataatacattgaaggctttaagggacatgattaaagaacgtgttcctcctggtacgatt
gtttattctattccttcggagggaatggtttcatcagttctgacaccagtatctgcacaa
ttggaagatttcagaaaacaaattaatattgtaaagaagaattttggaattactgatcat
catttgatttgtcattcacagggtggattgatttgtcgttcctatcttcaaacaactcct
gatcataatgtgaaggtgtttatttcattgagtggagttcaaaatggtgaatatggagtt
cctgtcggatttcaatttgaaggttttttgaaacaaatgttcccattcttgtttaacaca
gcccttgaagatgtttacaaaattttctatactgccaaagatgttgattatgcaagaaca
ttgaattatagagaaaacatgttgagaattgacaagatggttttgacaggtagtccacaa
gatgacattatcgttccttatcaatctgcattatttgaattttatcaagtcaactcaacc
ggaggtttggatatgattccaatggaacaacaacgaatctatcaaaatgatgtctttgga
ttgaaaaccctcaatgaggaaaatagattggtaagaattgttgtaccaaatgtttatcat
gtcgattggctttacaatccatcccttgttgacaagtgtatgattccatatttgtattaa

DBGET integrated database retrieval system