KEGG   Naegleria gruberi: NAEGRDRAFT_75961Help
Entry
NAEGRDRAFT_75961  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ngr  Naegleria gruberi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NAEGRDRAFT_75961
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NAEGRDRAFT_75961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 685 aa AA seqDB search
MQQQHSLKVSIIKCTDLPKVDLLGSCDAYVQVWVAHSDPNKFKQAQTDNEEGIKQTRVIT
SLNPEFNEQFQFKFPQVNSGMEKKDPMDKYLVVRVVDKNAILKDEVIGFVMIQFFGLNLK
VGKPLRRTYPLIDAKSGSIELFFEAVPSVGSNDLAVTNQNLPISELYDNTFMTVGPVIGT
VTSNSARVLVECSKAINLNVQVFGVCERSHFNVEESFFKKKRSGSHSKVLNNSLMTMKKQ
GICFSKTVSIEKSNTPFVFQLDGLKPDTVYRVEFGNICNGETRVGIIKTMIDEDKLSQIP
DSSHKLTINCVSCNFIERREPGKDTWERMLEQIDNTDVLLHMGDQIYADYGHNAFDEAVK
ICNSRNKVSNEEEELIKEEFRKYYRFNWNHIATRKVLSQVSNLMILDDHEIRDDWGSNPS
DQTQGSIPYYVGSLAREVYWEYQRSLRGDVSNKEEIFKKHEAYYNIIGDTGIVVLDLRAS
RSFLEHQSGNNLKFMTEDQWKDINNWILEEGGPLSSPKVKSLVIVCSVPLIFLNKKITDK
LPTLNSELDDFKDHFVFGDHFPEQLKLLELMKKWKEADSKRNGLFLGGDVHIGGSTSIYK
NGEVLCEQLTSSAICNSIIPLFESTLLKFLIGASDELVDGWSFKHGSWNKERNYGLVQIG
MNEKSNDKKCVINSYLNTHKEAFIK
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaacaacattctttgaaagtttccataataaaatgtactgacctgcctaaagtt
gacttgttgggatcatgtgatgcgtatgtgcaggtgtgggttgctcactcagatccaaac
aaatttaaacaagcacagactgataatgaggagggaattaaacagacaagagtgattact
agtttaaatccagaatttaatgaacaatttcaattcaaatttcctcaagtcaattctggt
atggagaagaaggatccaatggataaatatttggtagtgagagtggtggataagaatgcc
atattgaaggatgaagttattggatttgtaatgatacaattttttggattgaatttaaag
gtgggaaaaccattgagaagaacctacccattgattgatgccaaatctggaagtattgaa
ttgttttttgaagcagttccaagtgttggatccaatgatttggctgtcacgaatcagaat
ttaccaatttctgaattatatgacaatactttcatgacagttggtcctgtaattggtaca
gtaaccagtaatagtgcaagagttttggttgagtgctcgaaagctatcaatttgaatgta
caagtttttggagtttgtgagagaagtcatttcaatgttgaggaatcatttttcaaaaag
aaacgctctggttctcattcgaaagtgttgaataattcactcatgacgatgaagaaacaa
ggtatttgtttttcaaaaacagtttccattgaaaaatcgaatactcctttcgtatttcaa
ttggatggattgaaacctgacactgtttatcgagttgaatttggaaacatttgtaatggt
gaaactcgagtaggaatcatcaagacaatgattgatgaagataaattatctcaaattcca
gattcatctcacaagttgaccatcaattgtgtgagttgcaactttattgaaagaagagaa
cctggaaaggatacttgggaacgaatgctggaacaaattgacaatactgatgtacttctt
catatgggagatcaaatttatgctgattatggacataatgcttttgatgaagctgtcaag
atttgcaattctagaaacaaggtcagcaatgaggaggaggaattaatcaaagaggaattt
agaaagtattatagattcaattggaatcatatcgcaacaaggaaggtattatctcaagtg
agcaatttaatgattcttgatgatcacgagattagagatgattggggatctaatccatct
gaccaaactcaaggaagtatcccatattatgttggttctttggcaagagaggtctattgg
gaatatcaaagaagtttgagaggtgacgtttctaataaggaggaaattttcaaaaagcat
gaagcttattacaatataattggagatactggaattgtagttttagatttgagagcttct
cgaagcttccttgaacaccaatctggaaataacctcaaattcatgacagaagatcaatgg
aaggatatcaataattggattctggaagagggaggtccactttcatctccaaaagtgaaa
tctttagtcattgtttgctcggtgccactcatattcctcaataagaaaataacagacaaa
cttccaacgctgaatagtgaactagatgatttcaaagatcactttgtttttggagatcac
tttccagagcaattgaaattattagaattgatgaaaaagtggaaggaagctgattcgaaa
cgaaatggactattccttggaggtgatgttcacattggaggaagtacctccatctacaaa
aatggagaagtcttatgtgaacaattgacttcctctgcaatttgcaattccatcattcca
ttattcgaatccactcttctcaaatttctaataggtgcaagtgatgagctagttgatgga
tggtcgttcaaacacggaagttggaataaggaacgtaattatggattggttcaaattgga
atgaatgaaaagagtaatgacaagaagtgtgtcattaattcatatctaaatactcacaag
gaagcatttattaaataa

DBGET integrated database retrieval system