KEGG   Naegleria gruberi: NAEGRDRAFT_76251Help
Entry
NAEGRDRAFT_76251  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
ngr  Naegleria gruberi
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NAEGRDRAFT_76251
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NAEGRDRAFT_76251
   00670 One carbon pool by folate
    NAEGRDRAFT_76251
Enzymes [BR:ngr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NAEGRDRAFT_76251
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     NAEGRDRAFT_76251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 535 aa AA seqDB search
MMQSTSNLPKASSIPPMEAVVAVLLNSNGIGLNGNLPWLQDGLTEDMKHFVSVTCSSEPL
KFISPSMYKQSSSSSPITSDNTNDNTTTINDQLMNAVIMGRKTWESIPSKFKPLSKNRHA
IILSSKVNDDDQLMMERTTFVKNVDELFELLQNQKFNRIFIAGGTSIYKLLLPYTAVIHY
TNIIEQKGVNIQVDTRFPIRLLPSSDYRNVPINSNQFIAVDKSDKILPKNNERISHYEFI
TFERRHEEFQYLDIIKELILSDINVREERTGVGTVSKFGYQMKYSLRNNVFPLLTTKRVF
WKGVAKELFWFISGSTNAKILSEQDIHIWDGNGSREYLDSLGFENREEMDLGPVYGFQWR
HWGSSYENMHTDYTNKGVDQLKKCIETLKNNPTNRRIILSAWNVSDLPNMALPPCHLMCQ
FWVDTDTNELSCQMYQRSCDMGLGVPFNIASYALLTRLMAQVCNLKPGDFIHTLGDTHVY
KNHIEPLKKQIERDPKHFPLLLLDPSITNIDDFKFEHLTLQNYEPHATIKMEMAV
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaatcaacatcaaatcttccgaaggcttcatcaattcctcctatggaagccgtt
gttgcagttttattaaattccaatggtattggtttaaatggtaatttaccatggttacaa
gatggtttaaccgaagatatgaaacattttgtatctgtcacttgttcatcagagccttta
aaatttatttcaccttcaatgtataaacaatcatcatcatcatcacctataacaagtgat
aatacaaatgataatactactacaattaatgatcaattaatgaatgctgttattatgggt
agaaaaacatgggaatcaattccatcaaaatttaaaccactctcaaagaatagacatgct
attatattatctagtaaagtaaatgatgatgatcaattaatgatggaaagaacaacattt
gttaaaaatgttgatgaattatttgaattattacaaaatcaaaagtttaatcgtatattt
atagcaggtggtacaagtatttataaattattattaccatatacagcagttattcattat
acaaatataattgaacaaaaaggagtaaatattcaagtagatacaagatttccaattaga
ttattaccatcaagtgattatagaaatgtaccaattaattctaatcaatttattgcagtt
gataaatctgataaaattttacctaaaaataatgaaagaatttcacattatgaatttatt
acatttgaaagaagacatgaagaatttcaatatttagatattattaaagaattaatatta
tcagatataaatgtacgtgaagaaagaacaggtgttggtacagtttctaaatttggatat
caaatgaaatattcattgagaaataatgtatttccattattaacaactaaaagagtattt
tggaaaggtgttgctaaagaattattttggttcatttctggaagtacaaatgctaaaatt
ttatctgaacaagatattcatatttgggatggaaatggatcgagagaatatttagattca
ttgggatttgagaatcgtgaagagatggatttgggtcctgtttatggttttcaatggaga
cattggggtagttcatatgaaaatatgcatacagattatacaaataagggagttgatcaa
ttgaagaaatgtattgaaactttaaagaataatccaactaatagacgtattatattatct
gcatggaatgtatcagatttacctaatatggcattaccaccttgtcatttaatgtgtcaa
ttttgggtagatacagatactaatgaattaagttgtcaaatgtatcaaagatcatgtgat
atgggattaggtgttccatttaatattgcatcatatgctttattaacaagattaatggca
caagtttgtaatttaaaacctggtgattttattcatacattgggtgatacacatgtttat
aagaatcatattgaacctttgaaaaaacaaattgaaagagatccaaaacatttccctctt
ttattacttgatccttccattactaatattgatgattttaaatttgaacatttaacttta
caaaattatgaaccacatgctactattaaaatggaaatggctgtttag

DBGET integrated database retrieval system