KEGG   Naegleria gruberi: NAEGRDRAFT_77531Help
Entry
NAEGRDRAFT_77531  CDS       T01241                                 

Definition
O-Glycosyl hydrolase family 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ngr  Naegleria gruberi
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NAEGRDRAFT_77531
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NAEGRDRAFT_77531
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     NAEGRDRAFT_77531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 470 aa AA seqDB search
MNGKIISSISVVQSSLYTGDRLKLLNQPIQWIPNSNIKPNLKTFKLDSSIKYQSIIGFGC
ALTEASAFTFATMNEQIRNEILSLYWTSKGLNYTTARIHMNSCDFSLDNYSCDDVENDYQ
LTNFNIRRDKIFTLPLIKRVLNQVKLNYPKNGESFKIFLSPWSPPAWMKYNHEMNGSNQP
NGLINATNILDSWALHFSKFVTAYQNEGIDRIWGLTIQNEPEFAAPWDACCYTPEYQRDF
IKNHLGPRMRRDHPNLKIMIFDHNRDSVEKWASTIYSDPEASKYVDGMAFHWYVDGEYEN
LSRAHQVDKEKFLLATEACWGPGVSLGNWTRGEKYGFDIINDLNNYASGWTDWNCILDWQ
GGPNHLQNWCDAPIIADNRTQEIHIQPTYYFMGHFSKYLTQDSKRIHMFRPVNDQTLITS
FQTPDNKIITIVQNQQESILSFNLIDQDNHLYHAQIDVPPRTIRTLIYQK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtaaaataatttcaagtatttcagttgtacaatcatcattatatacaggtgat
agattaaaattattaaatcaaccaattcaatggattcctaatagtaatattaaaccaaat
ttaaaaacatttaaattagattcatctattaaatatcaatcaattattggatttggttgt
gctttaactgaagcctctgcatttacatttgcaacaatgaatgaacaaattagaaatgaa
attctaagtttatattggacttctaaaggattaaattatactactgctagaattcatatg
aattcatgtgattttagtttagataattatagttgtgatgatgttgaaaatgattatcaa
ttaactaattttaatattagaagagataaaatatttactttacctttaattaaaagagtt
ttaaatcaagttaaattaaattatcctaaaaatggtgaatcttttaaaatatttttatca
ccttggtctccacctgcttggatgaaatataatcatgaaatgaatggttcaaatcaacca
aatggtttaattaatgctacaaatattttagattcatgggcattgcacttttctaaattt
gttactgcctatcaaaatgaaggtattgatagaatttggggtttaactattcaaaatgaa
cctgaatttgctgcaccatgggatgcttgttgttatacacctgaatatcaaagagatttt
attaaaaatcatttaggacctagaatgagaagagatcatccaaatttgaaaatcatgata
tttgatcataatagagattctgttgaaaaatgggcatcaacaatttattcagatccagaa
gcaagtaaatatgtagatggtatggcattccattggtatgttgatggtgaatatgaaaat
ctatcacgtgctcatcaagttgataaagaaaaattcttattagcaactgaagcatgttgg
ggacctggtgtttcattgggtaattggacacgtggtgaaaaatatggatttgatattatt
aatgatttaaataattatgcaagtggatggactgattggaattgtattttagattggcaa
ggtggtccaaatcatttacaaaattggtgtgatgctcctattattgctgataatagaact
caggaaattcacattcaaccaacttattattttatgggtcatttctctaaatatttaaca
caagattcaaagagaattcacatgtttagacctgtaaatgatcaaactttaattacttca
ttccaaacacctgataataagattattaccattgttcaaaatcaacaagaaagtatttta
tctttcaatttaattgatcaggataatcatttatatcatgctcaaattgatgttccacca
cgtactattagaactttaatttatcaaaaataa

DBGET integrated database retrieval system