KEGG   Naegleria gruberi: NAEGRDRAFT_77897Help
Entry
NAEGRDRAFT_77897  CDS       T01241                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
ngr  Naegleria gruberi
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Ntox44
Motif
Other DBs
NCBI-GeneID: 8855297
NCBI-ProteinID: XP_002682852
JGI: Naegr1_77897
AA seq 110 aa AA seqDB search
MSEIPQGNATKGEKIFKARCAQCHTINKGGAHKVGPNLYGMWGRKSGLAEGYAYSAANKE
KGVTWNEQSLFDYLLDPKKYIPGTKMVFAGLKKPAERADLIEYMKNASQE
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaattccacaaggtaacgcaactaagggtgaaaagatcttcaaggccagatgt
gcccaatgtcacaccatcaacaagggaggtgctcacaaggttggtccaaatctctacggt
atgtggggtagaaagtctggtttggctgaaggttatgcctactctgctgccaataaggaa
aagggtgttacttggaatgaacaatccctctttgattatttgttggatcctaagaagtat
atacctggaactaaaatggtttttgcaggtttgaagaagccagccgaaagagccgatttg
attgaatacatgaagaatgcttctcaagaataa

DBGET integrated database retrieval system