KEGG   Naegleria gruberi: NAEGRDRAFT_77897Help
Entry
NAEGRDRAFT_77897  CDS       T01241                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ngr  Naegleria gruberi
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ngr00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 110 aa AA seqDB search
MSEIPQGNATKGEKIFKARCAQCHTINKGGAHKVGPNLYGMWGRKSGLAEGYAYSAANKE
KGVTWNEQSLFDYLLDPKKYIPGTKMVFAGLKKPAERADLIEYMKNASQE
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaattccacaaggtaacgcaactaagggtgaaaagatcttcaaggccagatgt
gcccaatgtcacaccatcaacaagggaggtgctcacaaggttggtccaaatctctacggt
atgtggggtagaaagtctggtttggctgaaggttatgcctactctgctgccaataaggaa
aagggtgttacttggaatgaacaatccctctttgattatttgttggatcctaagaagtat
atacctggaactaaaatggtttttgcaggtttgaagaagccagccgaaagagccgatttg
attgaatacatgaagaatgcttctcaagaataa

DBGET integrated database retrieval system