KEGG   Naegleria gruberi: NAEGRDRAFT_78018Help
Entry
NAEGRDRAFT_78018  CDS       T01241                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
ngr  Naegleria gruberi
Pathway
ngr03013  RNA transport
Module
ngr_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NAEGRDRAFT_78018
Messenger RNA biogenesis [BR:ngr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     NAEGRDRAFT_78018
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     NAEGRDRAFT_78018
Translation factors [BR:ngr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    NAEGRDRAFT_78018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 8856498
NCBI-ProteinID: XP_002682429
JGI: Naegr1_78018
AA seq 229 aa AA seqDB search
MQRTSSGSLLSEEIDNQQHPAEDIAEEHYEENVDPEFAQKHPLQQSWTLWYHNPPQFIQV
YTFEYVEDFWSVFNHIKPPTHLETGSAYYILKDGIRPEWEDPKNIHGGEWMFPFLRKKCN
VNDWWMNLAMALIGEFFDDGEIITGGCVAVRKSQFRLNIWVGDKSNDEAIVRIGQQFKES
LNHGSITGNTKQGDLSILTSHADQFTFDFKTFEDQLQGKKNVLHCIRID
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaacaagcagtggatccctactcagtgaagaaattgacaatcaacaacatcct
gcagaagacattgctgaagaacattacgaagaaaatgtagaccctgaatttgctcaaaaa
catccattgcaacaatcatggactttatggtatcataatccaccacaatttattcaagta
tacaccttcgaatatgttgaagatttctggagtgttttcaaccatattaaacctcctact
catcttgaaactggtagcgcttactacatcttgaaagatggtatcaggcctgaatgggaa
gacccaaagaatatccacggaggagagtggatgttcccattcttgagaaagaagtgcaat
gttaacgattggtggatgaatttagctatggctctcattggtgaattctttgatgatggt
gaaattatcactggaggttgtgttgctgttcgtaaatcacaatttagattgaacatttgg
gttggtgataagtctaatgacgaggctattgtacgtattggacaacaatttaaagagtct
ctcaaccatggttctatcactggtaacacaaagcagggtgatctttcaatcttgacttca
catgctgaccaatttacctttgattttaagacctttgaagatcaattacaaggaaagaag
aatgtccttcattgcattagaattgattag

DBGET integrated database retrieval system