KEGG   Naegleria gruberi: NAEGRDRAFT_78018Help
Entry
NAEGRDRAFT_78018  CDS       T01241                                 

Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
ngr  Naegleria gruberi
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NAEGRDRAFT_78018
Translation factors [BR:ngr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    NAEGRDRAFT_78018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 229 aa AA seqDB search
MQRTSSGSLLSEEIDNQQHPAEDIAEEHYEENVDPEFAQKHPLQQSWTLWYHNPPQFIQV
YTFEYVEDFWSVFNHIKPPTHLETGSAYYILKDGIRPEWEDPKNIHGGEWMFPFLRKKCN
VNDWWMNLAMALIGEFFDDGEIITGGCVAVRKSQFRLNIWVGDKSNDEAIVRIGQQFKES
LNHGSITGNTKQGDLSILTSHADQFTFDFKTFEDQLQGKKNVLHCIRID
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaacaagcagtggatccctactcagtgaagaaattgacaatcaacaacatcct
gcagaagacattgctgaagaacattacgaagaaaatgtagaccctgaatttgctcaaaaa
catccattgcaacaatcatggactttatggtatcataatccaccacaatttattcaagta
tacaccttcgaatatgttgaagatttctggagtgttttcaaccatattaaacctcctact
catcttgaaactggtagcgcttactacatcttgaaagatggtatcaggcctgaatgggaa
gacccaaagaatatccacggaggagagtggatgttcccattcttgagaaagaagtgcaat
gttaacgattggtggatgaatttagctatggctctcattggtgaattctttgatgatggt
gaaattatcactggaggttgtgttgctgttcgtaaatcacaatttagattgaacatttgg
gttggtgataagtctaatgacgaggctattgtacgtattggacaacaatttaaagagtct
ctcaaccatggttctatcactggtaacacaaagcagggtgatctttcaatcttgacttca
catgctgaccaatttacctttgattttaagacctttgaagatcaattacaaggaaagaag
aatgtccttcattgcattagaattgattag

DBGET integrated database retrieval system