KEGG   Naegleria gruberi: NAEGRDRAFT_78313Help
Entry
NAEGRDRAFT_78313  CDS       T01241                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NAEGRDRAFT_78313
Transfer RNA biogenesis [BR:ngr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    NAEGRDRAFT_78313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 556 aa AA seqDB search
MSRKKEPVVEGLSAAEAKVRASSEIVKELLKAYDSNETVVMAKVRARISRKYKLKTGPKL
VEIIAAIPEEHKSKLLPLLKAKPIRTASGIAVVAVMCKPHRCPHIAMTGNVCLYCPGGPD
SDFEYSTQSYTGYEPTSMRAIRARYNPYLQTRNRIDQLKRLGHDCDKVEFIIMGGTFMSL
EKEYRDEFIRNLHDALSGHTSSSVEEAIRYSEQSKQKCIGITIETRPDYCLKPHISNLLE
YGCTRLEIGVQSIYEDIARDTNRGHTVASVKRSFTLAKDQGYKIVAHMMPDLPNSDMERD
ILGFIEYFENPAFRTDGLKLYPTLVIRGTGLYELWKTGQYKNYSPDSLVDLVAKIMSLVP
PWTRVYRIQRDIPMPLVTSGVEKGNLRELALARMKDLGLKCRDVRTREVGIQSIHTKIIP
DEVELIRRDYCAQDGWETFLAYEDAAQDILIGLLRLRKCTQTDTTFRKELKNDQIAQASI
VRELHVYGSVVPVRARDPTKFQHKGYGTLLMEEAERIAREEHGSQKLLVISGVGTRHYYR
KLGYELDGPYMSKMLV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcaaaaaggaacctgttgtcgaaggactttctgctgccgaagcaaaagtaaga
gcttccagcgaaattgtaaaggaattattaaaagcctatgatagtaatgaaacagttgtg
atggcaaaagtcagagcacgtatttcacgtaaatataaattaaaaacaggaccaaaatta
gtagaaattattgcagccattccggaggaacataaatcaaaattattaccactcttgaag
gccaaaccaatccgtacagccagtggtattgctgttgttgctgtaatgtgtaaacctcac
agatgtcctcatattgccatgacaggaaatgtttgtttatattgtcctggtggtcctgac
tctgattttgaatactctacacaatcttatacaggttatgaacctactagtatgagagct
attagagctcgttataacccatatcttcaaactagaaatcgtattgatcaattgaagaga
cttggtcacgattgtgataaagttgaattcatcatcatgggtggtacatttatgagtttg
gaaaaggaatatcgtgatgaatttattagaaatttacatgatgctctctccggtcacacc
agttcaagtgtcgaagaagcaatcagatatagtgaacaaagcaagcaaaagtgtattggt
attactattgaaacaagacctgattattgtttaaagccacacatttctaatttattggaa
tatggttgtaccagacttgaaattggtgttcaatctatttatgaagatattgctcgtgac
acaaatcgtggtcacactgttgcttctgttaaacgttctttcacattggcaaaggatcaa
ggttacaaaattgttgctcatatgatgcctgacttgccaaactctgacatggaaagagat
attcttggatttattgaatattttgaaaatcctgcatttagaactgatggtcttaaactt
tatccaacattggttattagaggtacaggattgtatgaactgtggaagacaggacaatac
aagaattattcacctgattcattggttgacttggttgctaaaatcatgtcacttgttcct
ccatggacaagagtttaccgtattcaacgtgatattccaatgcctcttgttacaagtggt
gttgaaaagggtaacttgagagaattggctttggctagaatgaaagatttgggtttgaaa
tgtcgtgatgtcagaactagagaagttggtattcaatctattcacactaagattattcct
gatgaagttgaactcattagaagggattattgtgctcaagatggttgggaaactttcctt
gcttatgaagatgctgctcaagatattttaattggtttattacgtttgagaaaatgtact
caaactgatactactttccgtaaggaattgaagaatgaccaaattgcccaagcaagtatt
gtaagagaattacacgtttatggttctgttgttcctgttcgtgccagagatccaactaaa
ttccaacacaagggttatggtacattactcatggaagaagctgaaagaattgccagagaa
gaacatggcagtcaaaaactcctagttatcagtggtgttggtactagacattattataga
aaattaggctatgaattggatggtccatatatgagtaagatgcttgtgtaa

DBGET integrated database retrieval system