KEGG   Naegleria gruberi: NAEGRDRAFT_78680Help
Entry
NAEGRDRAFT_78680  CDS       T01241                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ngr  Naegleria gruberi
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    NAEGRDRAFT_78680
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     NAEGRDRAFT_78680
Exosome [BR:ngr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NAEGRDRAFT_78680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 640 aa AA seqDB search
MNIMIGLQNNLGTKVTLLKTKYCCSLHTARFGALNDSINAAIAATEQDNFNHKTQSSLIF
HQQAYHHSPKNFPTEKKFSNSNRRYHRGQVAFGLDNSSSVNTKYNIGLISNSSGAFVSRN
YSKMMGEKRKVVGAIDQGTTSTRFMLFDASDMKEVASYQILHENHFPKPGWVEQDPIEIY
TNTLECMTNACEKLEGEDYEIIGIGVTNQRETTVLWDSETGKPLCKSIVWNDTRTRDLVD
SICKSKAGGDYSKFREVCGLPLSTYFSAVKLRWMIDHYDEVKKAVDKGTCMFGTVDSWLI
WNLTGGLKGGIHITDVTNASRTMLMNLKTLKWDDDMLNLFEIPSGVKLPTIKSSAEVYSS
ISKEVVQNHPLLSGVAISGCIGDQQSATIGQKCFKIGDTKNTYGTGCFLLMNCGHEIVKS
NHGLLSTVQYQLGPNAAPVYALEGSVAVCGSGISWLEHNLKLIENPAESETLARTVEDTG
GVVFVPAFSGLYCPYWRSDARGTIVGITHYTNSAHIVRAMLEAVCFQTQEVLESMVKDSG
LAVTNLMVDGGMTKNQLLMQLQSDISRKKVKVPSYPETTVLGAAICAAFGVGHFKEIKDI
PPSPKDKMLIFTPHISEQETELKMKRWKKAIEKSLNWHEE
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcatgattggcttgcaaaacaacctcggaacgaaggttacactgctcaaaacc
aaatactgttgttccctccacacagctagatttggagcattgaacgatagcatcaatgct
gctattgctgctactgagcaagataatttcaatcacaagacacaatcatctttaattttc
catcaacaggcttatcatcattctccgaagaattttcctacagaaaaaaaattctcaaac
tctaatcgtcgttatcatcgaggacaagttgcctttggattggataatagtagtagtgta
aataccaaatataatattggattgataagtaatagtagtggagcatttgttagtagaaat
tattcaaaaatgatgggagagaagagaaaagttgtcggagctattgatcagggaactact
tcgacgagatttatgttgttcgatgctagtgatatgaaggaagtggcctcttatcaaatt
ttacatgaaaatcattttcctaaacctggatgggttgaacaagatcctattgaaatttat
acaaatacacttgagtgcatgactaatgcatgtgaaaaattagaaggagaggattatgaa
attattggtattggtgtgactaatcagagagaaacaacagtgttgtgggattcagaaact
ggaaaaccactttgtaaatcaattgtttggaacgatacaagaacaagagatttggtcgat
tccatttgtaaatcaaaagctggaggtgactactccaaatttagagaagtttgtggtctt
ccactttccacatatttcagtgcagttaaactgagatggatgattgaccattatgatgag
gtaaaaaaagcagtcgataaaggaacttgtatgtttggaactgttgacagttggttgatt
tggaatttaacaggtggcctgaagggtggtattcacattacagatgttaccaatgccagt
agaaccatgttaatgaacttgaagacacttaaatgggatgatgatatgctcaatctcttt
gaaattccatcaggtgttaaacttccaaccatcaagagtagtgctgaagtttattcaagt
atttctaaggaagttgtacaaaatcaccctcttttaagtggagtagccatttctggatgt
ataggagatcaacaaagtgccactattggccaaaagtgttttaaaattggagatacaaag
aatacatatggaacaggatgtttcttacttatgaattgcggacatgaaattgttaaatcc
aatcacggattattatcaacagttcaatatcaactaggaccaaatgctgctccagtctat
gccttggaaggttctgttgcagtttgtggatctggtatttcatggttggaacataattta
aaactcatagaaaatccagcagaatctgaaacacttgccagaacagttgaagatactgga
ggtgtagtttttgttcctgccttctctggattatattgtccatattggagatctgatgca
cgtggtactattgttggtattactcactatacaaactctgcccacattgttagagccatg
ttagaagctgtatgtttccaaacacaagaagtacttgaatccatggtgaaagatagtgga
cttgctgttacaaacttgatggttgatggtggtatgaccaagaatcaattattaatgcaa
cttcaatctgatatcagtagaaagaaagttaaagttccatcctatcctgaaacaacagta
ttaggagctgcaatttgtgctgcatttggcgttggacatttcaaggaaatcaaggatatt
ccaccatctccaaaagataagatgttaatattcactcctcacatctctgagcaagaaact
gaactcaaaatgaagagatggaagaaggccattgaaaagtcattaaattggcatgaagaa
taa

DBGET integrated database retrieval system