KEGG   Naegleria gruberi: NAEGRDRAFT_78703Help
Entry
NAEGRDRAFT_78703  CDS       T01241                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
ngr  Naegleria gruberi
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NAEGRDRAFT_78703
Exosome [BR:ngr04147]
 Exosomal proteins
  Proteins found in most exosomes
   NAEGRDRAFT_78703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 1692 aa AA seqDB search
MSNQIPIQFTELFNLQNLGVNSQSISFTTVTLESDKFVCVRDQVSPNKSIQIVEVDSQNV
TSNKVNADSAIMHPTAKVLALRAGNTIQIFNLEMKAKMKEHTMTEQVVFWRWINTNTIAI
ITATAVYHWSMDGQSAPKKMFDRHANLANSTIINYRTDSNLQWLLLIGLTRAEDNSTKGV
MQLYSVEKKVTQPIEGHAACFVDYKLSNNFVTTVVCIASSTPQGGKLFVMEVPSNKPQDA
PAFERKAVPIQFPAQGDFPVAMQASDRHGVFFMITKSGFLYMYDVESATLIFKNRISDDA
LFITAQRAGGFIGVNKRGQVLSVTVDDNTIIPYIANQLGDQGLSLKISSRANIGGNMVGD
LYLQQFNAQLNQMNVQAAIALAADSPQGILRTPDTIARLQRLPVMQGQKPAISQYFQYII
EKGKLNTYESLELAKIVLQKQGGVDYLKKLLTDDKIEGSQDLGDFISGYSQELAMQIYLK
GKAHDKIIDSLLRMGDYERVLAYCQKVEYTPDYYDIFRKLCMVNPDSAVKFASKIHENPE
TRIDPNTVIDLLVQGNLIKQVTAYLLDILKNDRPEEGALQTRLLEINLTYSPIQVVDSIL
GQKLVNHYDRIKIARLCEKAQLFQRALENYTDPADRKRVIVNTHAINVEWLIKWFEDVSK
QEVFMYLRELIKNKNNLQVVVKVATANSSVLEPENLIPIFEEVKSNEGLYYYLGSIVNFS
QDPQVHNKYIMAATRVNQLSEVERVTRESDYYEADVIKEFLKEARLTNQMPLINVCDKHG
YIDEMVRYLYSNSQLKFIDMYAKSVNPIRTPEVVGALLDVDASEDFVRNLIMGVGNMCPT
EPLVEEVEKRNKLKLLLPWLEARVNEGSQEPGCHNALAKIYIDLSQNAENFLINNQFYDS
RVVGQYCEKRDPHLAFVAYKRGQCDLELVAVTNKNGMFKQQARYLVERQSPELWAHVLDN
ENTYRRQLIDQVVQTALPESKSSDEVSTTVKAFMTANLPNELIELLEKIVLHGSSEFKTN
RNLQNLLILTAISAERTRVMDYINRLDKYDAADIARVAITKELYEEAFVMYSKNKLNTDA
IRVLIDHIQSITRAAEFAKIVNEAECWSILARAQLNALVVADAIESFMKADDPTDYHNVI
QYAEQQDEYKALIKFLEMARKKIQDSVIDTELVYSYAKYSKLKNKPEVLADMEDFISGPN
LAQIQVVGDRLFDEQIYNAARTLFQSISNYARLTSTLIKLGLLREAVSSAQKANSIKSWK
EVMMACIDASEFRYAQSCALNIIVHADELEDLLHYYEQRGYFEQVIELMEKGLGLERAHM
GIFTELGVLYAKYRPEKLMEHITRYWGKCNIPKLLNAAEQNHLWAEMRFLYCHHDEPDAA
VKVMMEHSTEAWDHSVFTETIIKVVNMELYYRAIQFYILENPKYLEDLLVVLTPKLDHER
VARDIRYQNNGLDLPLIKKYLETVQDHDLPQVNEALNSLYIEEEDYLALKRSLEQYRNLD
QLSLAAQLEGHDLLEFRRIASWLYKINKQWENSIKLSKKDNLYKDAMETAAESQKQDIAE
DLLKFFVSKGLKDCFAAALYNCYNFVRPDIALELAWRNNIIDMVMPYMVQVLREYTTKVD
DLVQESRQKKKEAELKSQQPTPEVGGYVDPNAAYGQTADAYGANYGQQYGNVGYDQYGAN
YGQQYGNGGYGF
NT seq 5079 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccagatcccaatacaatttaccgaactttttaaccttcaaaacttgggggta
aactcacaatccatttctttcaccacggttacactcgaatctgacaaattcgtctgtgtt
agggatcaggtctcacccaataaatctattcaaatagtcgaagttgatagtcaaaatgtt
acctcgaataaagtcaatgctgactctgccattatgcacccaacagctaaggtgctcgct
cttagagctggtaacactatacaaatcttcaacttggaaatgaaggcaaagatgaaggaa
cacacaatgactgaacaagtcgttttttggagatggatcaacactaacactattgctatc
attaccgctaccgctgtttatcactggtctatggatggtcaaagtgcaccaaagaagatg
tttgatcgtcatgccaatcttgccaattccacaatcatcaattatagaacagattctaat
ctccaatggttgcttttgattggtttgaccagagctgaagacaactctacaaagggtgtt
atgcaattatattcagtagaaaagaaagttacccaaccaattgaaggtcacgctgcttgc
ttcgttgattacaagctttccaacaattttgttaccactgttgtttgtattgcttcaagc
actccacaaggtggtaagcttttcgttatggaagtcccatcaaacaagccacaagatgct
cctgcttttgaaagaaaggctgttccaatccaattccctgctcaaggtgatttccctgtt
gctatgcaagctagtgatagacatggtgttttctttatgatcaccaaatcaggatttttg
tatatgtatgatgttgaatcagctacactgatcttcaagaatcgtattagtgatgatgct
ttgtttattacagcacaaagagctggtggttttattggtgttaataagagaggtcaagtt
ttgtctgtcactgttgatgataataccattattccatatattgctaatcaattgggtgac
caaggattatctttgaagatttcttcaagagccaacattggtggtaacatggttggtgat
ttgtatttgcaacaattcaatgctcaattgaaccaaatgaacgttcaagctgctattgct
cttgctgctgattctccacaaggtattttgagaactccagatactattgctagactccaa
cgtttgccagttatgcaaggtcaaaagccagctatttcccaatacttccaatacattatt
gaaaagggaaagcttaacacttatgaatcacttgaattggctaagattgttttgcaaaag
caaggtggtgttgattatttgaagaagttgttgactgatgacaagattgaaggaagccaa
gatttgggtgactttatttctggttatagtcaagaattggctatgcaaatctacttgaag
ggtaaggctcacgacaagattattgattctttgttgagaatgggtgattacgaaagagtt
ttggcttactgtcaaaaggttgaatatacccctgactattatgatatcttcagaaagtta
tgcatggttaacccagatagtgctgtcaagtttgcttcaaagattcatgaaaatccagaa
acaagaattgatcctaatactgttattgatcttttggttcaaggtaatctcatcaagcaa
gttactgcttaccttttggacattcttaagaatgatagaccagaagaaggtgctctccaa
actagattgttggaaattaacttgacttacagtccaattcaagttgttgattcaattctc
ggacaaaagcttgttaatcattatgatcgtattaagattgccagattgtgtgaaaaggct
caactcttccaaagagctcttgaaaattacactgacccagctgatagaaagagagttatc
gtcaatactcatgctattaatgttgaatggttgattaagtggttcgaagatgtttccaag
caagaagttttcatgtatttgagagaattgattaagaataagaataatctccaagtcgtt
gttaaggttgctactgccaacagcagtgttttggaaccagaaaatcttattccaatcttt
gaagaagttaagagtaacgaaggtctctattattatttgggttctattgttaacttcagc
caagatcctcaagttcacaacaagtacatcatggctgctactagagttaaccaactttct
gaagttgaaagagttactcgtgaaagtgactactatgaagctgatgtcatcaaagaattc
ttgaaggaagctagattgactaaccaaatgccactcattaacgtttgtgacaagcatggt
tacattgatgaaatggttagatatctctacagcaacagtcaactcaagttcattgatatg
tatgccaagagtgttaacccaatcagaactccagaagttgttggtgccctcctcgatgtt
gatgccagtgaagattttgttagaaatctcattatgggtgttggtaatatgtgtccaact
gaacctttggttgaagaagttgaaaagagaaacaagctcaagttgttgttgccatggttg
gaagctcgtgttaacgaaggaagtcaagaaccaggatgtcacaatgctttggctaagatc
tatattgatctcagtcaaaatgctgaaaacttcttgattaacaatcaattctatgattcc
agagttgttggtcaatactgtgaaaagagagacccacacttggcctttgttgcttacaag
agaggtcaatgtgacttggaattggttgctgttactaacaagaatggtatgttcaaacaa
caagccagataccttgttgaaagacaatcccctgaattgtgggctcacgttttggataac
gaaaatacttacagacgtcaacttattgatcaagttgtccaaactgctctcccagaaagc
aagtcaagtgatgaagtttctaccactgttaaggctttcatgactgccaaccttccaaac
gaattgattgaattgttggaaaagattgttttgcacggatcctcagaattcaagactaac
agaaacttgcaaaacttgctcatcctcactgctatcagtgctgaaagaactcgtgtcatg
gattacattaacagattggacaagtatgatgctgctgatattgctagagttgctatcacc
aaggaattgtacgaagaagctttcgtcatgtacagcaagaacaagttgaatactgatgct
atcagagttttgattgatcatattcaatccatcactagagctgctgaatttgccaagatt
gttaacgaagctgaatgttggagcattttggctagagctcaattgaatgctctcgttgtt
gctgatgctattgaatccttcatgaaggctgatgatccaactgattaccacaatgttatt
caatatgctgaacaacaagatgaatacaaggctttgattaagttcttggaaatggccaga
aagaagattcaagactctgttattgatactgaattggtttactcttatgctaagtactcc
aagcttaagaataagccagaagttttggctgatatggaagatttcatttctggaccaaac
ttggctcaaatccaagttgtcggtgacagacttttcgatgaacaaatttacaatgctgct
agaactctcttccaatctatttctaactatgctcgtttgacatccactttgatcaagtta
ggtttgttgagagaagctgtttcatctgcccaaaaggctaactctatcaagtcatggaag
gaagttatgatggcttgtattgatgctagcgaattcagatatgctcaatcatgtgctttg
aacattattgttcatgctgatgaattggaagatctcctccattactatgaacaaagagga
tactttgaacaagttatcgaattgatggaaaagggcttgggtcttgaacgtgctcatatg
ggtattttcactgaattgggtgttttgtatgccaagtatagaccagaaaagcttatggaa
cacattactcgttattggggtaagtgcaacattccaaagttgctcaatgctgccgaacaa
aaccacttgtgggctgaaatgagattcttgtactgtcatcatgatgaacctgatgcagca
gtcaaggtcatgatggaacactcaactgaagcttgggaccactctgtcttcactgaaacc
atcatcaaagttgtaaatatggaactttactatagagctatccaattctatattctcgaa
aatccaaagtatcttgaagatttattggttgttttgactccaaagttggatcatgaaaga
gttgctcgtgatatcagataccaaaataatggtttggatctcccacttattaagaagtat
ttggaaactgttcaagatcatgatttgcctcaagtcaatgaagctcttaacagcttgtac
attgaagaagaagattaccttgctttgaagcgttctcttgaacaatacagaaatcttgac
caattatctcttgctgctcaattggaaggtcacgatctccttgaattcagaagaattgct
tcttggttatataagatcaacaagcaatgggaaaattccatcaagttgagcaagaaggat
aacttgtataaggacgccatggaaactgctgctgaatctcaaaagcaagatattgctgaa
gatctccttaagttcttcgtttctaagggtttgaaggattgtttcgctgctgctttgtac
aattgttataactttgttcgtccagatattgctcttgaattggcttggagaaataacatt
attgacatggttatgccatatatggttcaagttcttcgtgaatacaccactaaggtcgat
gatctcgttcaagaaagtcgtcaaaagaagaaggaagctgaattgaagtctcaacaacca
accccagaagttggtggttatgttgatccaaatgctgcttatggacaaactgctgatgct
tatggtgctaactatggccaacaatacggaaatgttggttatgatcaatatggtgctaac
tatggtcaacaatacggaaatggtggttacggattttaa

DBGET integrated database retrieval system