KEGG   Naegleria gruberi: NAEGRDRAFT_79564Help
Entry
NAEGRDRAFT_79564  CDS       T01241                                 

Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
ngr  Naegleria gruberi
Brite
Chromosome and associated proteins [BR:ngr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    NAEGRDRAFT_79564
Exosome [BR:ngr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NAEGRDRAFT_79564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF GMP_synt_C
Motif
Other DBs
NCBI-GeneID: 8850267
NCBI-ProteinID: XP_002677696
JGI: Naegr1_79564
AA seq 163 aa AA seqDB search
MPAKTKKSTESKDKTKETKKDKVTKKTTKASGDGEEGEKDDKKKKSRHESYSSYIYKVLR
QVHSDIGISTKAMSIMNSFIQDIFERIANEAAQLCRVNGTKTLSSREIQTAVRLILPGEL
AKHAVSEGTKAVTKYQTSSGKTAPKKREKKEKKEKSEKATESK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgccagctaagactaagaaatccactgaaagcaaggataagaccaaggaaaccaagaag
gacaaggttaccaagaagactacaaaggcttccggtgatggtgaagaaggtgaaaaggac
gacaagaagaagaagtctagacatgaatcctactcttcatatatctacaaggtcttgaga
caagtccactctgatattggtatttccaccaaggctatgtctatcatgaactctttcatc
caagatatctttgaaagaattgccaatgaagctgctcaattgtgtagagtcaatggtact
aagactttgtcttctcgtgaaatccaaactgctgtcagattgatccttccaggtgaattg
gctaagcacgctgtttctgaaggtaccaaggctgttaccaagtatcaaacttcatcagga
aagactgctccaaagaagagagagaagaaggaaaagaaggaaaagtctgaaaaggctact
gaaagcaagtaa

DBGET integrated database retrieval system