KEGG   Naegleria gruberi: NAEGRDRAFT_79564Help
Entry
NAEGRDRAFT_79564  CDS       T01241                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
ngr  Naegleria gruberi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 163 aa AA seqDB search
MPAKTKKSTESKDKTKETKKDKVTKKTTKASGDGEEGEKDDKKKKSRHESYSSYIYKVLR
QVHSDIGISTKAMSIMNSFIQDIFERIANEAAQLCRVNGTKTLSSREIQTAVRLILPGEL
AKHAVSEGTKAVTKYQTSSGKTAPKKREKKEKKEKSEKATESK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgccagctaagactaagaaatccactgaaagcaaggataagaccaaggaaaccaagaag
gacaaggttaccaagaagactacaaaggcttccggtgatggtgaagaaggtgaaaaggac
gacaagaagaagaagtctagacatgaatcctactcttcatatatctacaaggtcttgaga
caagtccactctgatattggtatttccaccaaggctatgtctatcatgaactctttcatc
caagatatctttgaaagaattgccaatgaagctgctcaattgtgtagagtcaatggtact
aagactttgtcttctcgtgaaatccaaactgctgtcagattgatccttccaggtgaattg
gctaagcacgctgtttctgaaggtaccaaggctgttaccaagtatcaaacttcatcagga
aagactgctccaaagaagagagagaagaaggaaaagaaggaaaagtctgaaaaggctact
gaaagcaagtaa

DBGET integrated database retrieval system