KEGG   Naegleria gruberi: NAEGRDRAFT_79744Help
Entry
NAEGRDRAFT_79744  CDS       T01241                                 

Definition
ubiquitinyl C19 peptidase
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NAEGRDRAFT_79744
Peptidases [BR:ngr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NAEGRDRAFT_79744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 1291 aa AA seqDB search
MYPSSSPINEDSISQIVDAGFGRDQAIQALRKCNNNVERAFDLLLAASDDPSVLSMENDQ
QSNNQVAVVHHHHHHEDEPTIDDTVVYGGSNHHHHHHSAADDVVNRYNYDSDDSTTATTS
GEVSPVMYTSNNEFKHHHNQHHHHEQEEEKHIDDPDMPNLEDDTVISNSHRNDDFYFDTS
FDQLSPTTVNNNRHNTDDDYFSTNNNNKNNRQFSSSNNTSFEDDALNRAIEASLQDQKRD
SEPKSPIEKYRKQLHVPIGLKNIGNTCYVNSLFQALFMIPKLKQLLFSFSEESFMSRVQA
KIEKSLTTTSSATTDKRITQHQQVYSNENLQKQADKDLTFIKESQKLFASMIMTNKTFID
PSPLVEALSKEGIDVNLGHQEDISEFYSKVLILLERMFSEEWEEKIENKTNNISLENPIK
QIFYGICTEELEYLDTESTKVCISKYSELCNLILNVSEQLKDFYSSLDDYSITEVADYAV
STSYKTKAVKTTWFKTPPPVLLVQLQRTSFDTTKKVAHKINLPFEFQEVIYLDRYLETNK
VKTTTKRENIKQIKQKIADLEKQLDGYLNYNDNKGISIEYLFAGALEYVAQYQHELSGGT
SVQSIESAVKVFENIRQQVSKKVEKLKNEIDTLKENVATMFDDMKEKPYDLCGILVHEGS
LASSGHYYIYYFDTGQNCWWKFNDMKVTEVTEEEVMRTSSGIDKDINSSAYCLLYVDNSR
VNLEEKDFISKDKHLQDSIEQNIKELKESLKKLKKADSCHDDHHHHHHHHHGCCSGHHHH
HNEEHNDQEAKPATVEEKIPTEHSGLEVDSLEQIIADYPKTYRDVLMEISIERWRAIIPK
EVQDELNFQNKKFIEELNIYIEQQKEKREREKKQFQHQYNELCNKCFQLCQGQVNSTYTY
SMSLQYDARIANYPVFLCAIDQIVPMKYTIADQVFYSLFQRKLLDLCASSEKSDQNKFNE
YMALVNLTVDDIPNTKVVSSLNELYSLFCFVATWYHYGLHYLYRKTFDRSISSFLMGIIY
DKELTELHGDKKLSREKDILTYTAVCLQQIYSRGLKTISKNFKEAMNWIKYSIEYLPLVW
NSTLSTNDFVMDKILNYFPTYINGNNVRIQHYCSQQEIEEIISYWQYLQGHVIFRNYNIR
KELKALEKQENSSPEFLELVQQKTQLLKSTNAEIKSLKQQLLSQNRESYHIPFPDDAERL
AKAISSEIHNVEMEYARDIQIQPMLNNDTDLLEEDEFTETVADHSTTTTTTSKYRVETDV
DSPPEKSSEVTPSGTSGSRPSSPSDQEYDLD
NT seq 3876 nt NT seq  +upstreamnt  +downstreamnt
atgtatccgtcgtcgtcaccgatcaatgaggattccatcagtcagattgtagatgctggt
tttgggagagatcaggcaatacaggccttgaggaaatgcaataataatgttgagagagcc
ttcgatttgttattggcagcttcggatgatccgagtgtattatcgatggagaatgatcag
cagtctaataatcaagtagctgttgttcatcatcaccatcatcatgaagatgaacctaca
attgatgatacagttgtgtatggaggatctaatcatcatcaccatcatcactctgcagca
gatgatgtagtaaatagatataattatgattctgatgattccacaactgctacaacaagt
ggagaagtctctccagtcatgtacacttctaataatgaatttaaacatcatcacaatcaa
catcatcatcatgaacaagaagaagaaaagcatattgatgatcctgatatgccaaacctt
gaggatgacactgtaattagcaatagtcatagaaatgatgatttctactttgatacatcc
tttgatcaactctctccgacaactgttaataataatagacacaataccgatgatgattac
ttttcaacgaataataataacaaaaataatagacaattctcatcatcaaataatactagc
tttgaagatgatgcactcaatagagccattgaagcatcattacaagatcaaaaacgagat
tctgaaccaaaatctcctattgagaaatatagaaaacaactacatgttcctattggattg
aaaaatattggaaatacttgttatgtcaattcgttatttcaagcactttttatgattccc
aagttgaaacaattgttattctcattttctgaggagagttttatgagtagagttcaagca
aagattgaaaaatcattaaccactacaagtagtgcaacaacagataagaggattactcaa
catcaacaagtttactctaatgagaatttacaaaagcaagcagataaggatttgacattc
attaaggaatctcaaaaattgtttgcaagtatgatcatgactaacaagacatttattgat
ccatctcctcttgtagaggctctttcaaaggagggaattgatgtcaatcttggacatcaa
gaagatattagtgaattctatagtaaggttttgatcctacttgagagaatgttctcagag
gaatgggaagaaaaaatcgagaacaagaccaacaatatcagtcttgaaaacccaatcaaa
caaattttctatggtatctgtacagaagagttggagtatttggatacagagtcaacaaaa
gtctgtatcagtaaatactctgaactttgtaatttaattttgaatgtgagtgaacagctg
aaagatttttattcttctctcgatgattattctatcactgaggttgcagattatgctgtc
agcacatcttacaagacaaaagctgtaaaaactacctggtttaaaacaccaccacctgta
ttattagttcaactccaaagaacctcttttgatactaccaaaaaggttgctcacaagatt
aatctaccatttgaattccaagaggtgatttatttggatagatatctggagacgaacaaa
gttaaaactacaactaaacgagaaaatatcaaacaaatcaaacaaaagattgcagatttg
gaaaaacaattagatggctatttaaattataatgataataagggaatttccattgaatat
ttatttgcaggcgctctcgaatatgtagctcaatatcaacacgagctatcaggaggtacc
tctgttcaatctattgaaagtgctgtcaaggtatttgagaatataagacaacaagtttct
aaaaaggttgaaaagttaaagaatgaaatcgatactctcaaagaaaatgttgctaccatg
ttcgatgatatgaaggagaaaccatacgatctgtgtggtattctagttcatgaaggaagc
ttggcttcgagcggacattattacatttactattttgatacaggtcaaaattgttggtgg
aaattcaatgatatgaaggtgactgaggttactgaagaggaagtcatgagaacttcaagt
ggtattgacaaggatatcaactctagtgcttactgcctcttatatgtggataatagtaga
gttaatttggaagagaaagactttatttcaaaggataagcatctccaagattctatcgag
cagaatatcaaggagctcaaggaatccttgaagaaattgaagaaggcagacagctgtcat
gatgatcatcatcaccatcatcaccaccatcatggctgttgcagtggacatcaccaccat
cataatgaagaacataatgatcaagaagctaaacctgccaccgttgaagaaaaaattcca
acagagcactctggactcgaagttgattcgcttgagcaaattatcgccgattatcctaaa
acttacagagatgttctcatggaaatatccattgagagatggagagctatcattccaaaa
gaggttcaggacgaattgaatttccaaaacaaaaagtttattgaggagcttaatatttat
attgaacaacaaaaggaaaagagagaaagggagaagaagcaattccaacaccaatataat
gagctctgcaataagtgcttccaactctgtcaaggtcaggtcaatagcacttacacttac
tccatgtccttgcagtatgatgcaagaattgccaactatccagtgttcctctgtgccata
gatcaaattgttccaatgaagtataccattgccgatcaagtattctactcactcttccag
agaaagctcttggatttgtgtgcaagctctgaaaaatccgatcaaaacaaattcaacgaa
tacatggcacttgtgaacttgactgtggatgacataccaaataccaaggtggtatcttct
ttgaatgagttgtactcattattctgctttgttgcaacttggtatcattatggattgcat
tatttgtacagaaagacatttgatagatctattagctcattcttgatgggtattatttat
gataaggagctcacagaattacatggagataagaaattaagtagagagaaggatattctc
acatacactgctgtctgtttacaacaaatttattcaagaggtttaaagacaatttcaaag
aatttcaaggaagctatgaattggatcaaatactcgattgagtatcttcctcttgtttgg
aatagtactctctccacaaacgattttgttatggataagattttgaattatttcccaacg
tatatcaatggcaacaatgttagaattcaacactattgctcccaacaagaaattgaggaa
attatcagctattggcaatacctgcaaggacatgttattttccgaaattataatatcaga
aaggaactcaaggcacttgagaaacaagagaattcatcaccagaatttttggaacttgtc
caacaaaagacacaattgctcaagagtaccaatgctgaaattaagagtctgaagcaacaa
ttgctctctcaaaacagagaatcctatcatattccattcccagatgatgctgaaagattg
gccaaagcaatttcttctgaaattcacaatgttgaaatggaatatgccagagacattcaa
attcaaccaatgttgaataatgatactgacttgttagaagaggatgaatttactgaaaca
gttgcagaccattcaacaaccacaacgactacatccaaatatcgtgttgaaactgatgtt
gatagcccaccagaaaagtcatcagaagttacaccatctggaacctcaggttcacgacct
tcctctccatctgatcaggaatatgatttggattaa

DBGET integrated database retrieval system