KEGG   Naegleria gruberi: NAEGRDRAFT_80016Help
Entry
NAEGRDRAFT_80016  CDS       T01241                                 

Gene name
AM3
Definition
hypothetical protein
Orthology
K04437  
filamin
Organism
ngr  Naegleria gruberi
Brite
Exosome [BR:ngr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NAEGRDRAFT_80016 (AM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 1278 aa AA seqDB search
MAEETTSANGFITLMTNIQDFLSEAHTLTERTTRELEMSGTKQTMRKVSDSNWEETQTRA
FTKWVNSHLKKREGIALVENLINDVQTGVPIFVLYEIISGEKLGKMYNNPESKFHKIANL
NIVIDRINQVVETMGIKLQFSAEQVFNGEKRQILGLIWTLILRFQITKTLEIEQPIVKVD
TPPVKVESNEEHKEAVPVVEPVKQQHTTKPQKKTNAGDSAKMELLKWVQEKLVPYAGEFL
VKDFTSSWQDGKALAALISTLKPRALKYKKIDFVNTTPLEINRESIRIAEEELDIPEIID
PEDITDSPEELSLMTYISYFRDYDRLHPEEQIEEEEVPEEPVVEIIEDIRPEIDPSKCIA
EGPAFDESNPPIPGQPTHFTIVTYDEEGNKYIPKSTEDDENQITVNLFSPYVSEEIPEPD
IKNNGDGTYDVSFVVPVGAKDLKALIVVNGESIQGTPHSVPNASIFDPAKSIVVGEGVQP
YNLYVDEITDFVVECRDTNGANILQSVPDLQFDLVLKDTDTGNEYPVKAQQVDNADGTYT
ISYVPDCPSGSYELSVLTNKGEKVGNSPFDVTFQQKVMPAQCVAKGNGILPFGLKTGVAT
SFTIEINDKNGKIIPYADEEILVDILSGDELVEPSDYFLTVTNNQNGTYTVNYKPKKAGT
HFISVKCNDENISQSPFKVEISTLPSAPNSKLKLVSVKSLPNLIEQEIDLKALDSFGVKT
AKNCKLVALVEDDDGNLIPATIVPGEDDKLKVVFKPTKAGQKYKTKILMDGVPVGDSFTV
QHKPILSCPLTRVFGPGLNGADLFSKDSVPAMFKIKSIDNNRNPYLQSNLQPVKASAKKL
KRLAKSIFKEPDYFTDLLNPQYDLQLDDESVVESIDFSKSVDLDEVRPALERHIKATPFK
VIVKNENTGEDIPAIVFNTAPAEYTVFYNPTTAGPISISVVDKKDQHPVADSPYQAFVTE
GVNPMLCQVKGPALLKAYKGRPTYLTILPRDANNSPISVGGHEFYANLADNNGVSCIVPL
TIVDNNNGTYDVKFTPQAKGKHLISIKHDGQDLKDSPFPIFVRDDEFAPYAKNCQVFDNP
SKMKTTKPRHFFVQMKDKDNNPILSGGDPLKATLKTPEGKLVQHLAVIDPNTGKYKIPLN
PKVPGKYIVTCSLGDEEDGGEVISGSPFHLNVTPGISPLKTEIGDWEFDIQTAQDNEPED
LFIKIKSPSGKVISPTIIKCPRPENHQPNDDDEYSKGDRFKLIIRTTEVEKGDYLIYANI
CGYPVKGSPFKQTLDVRC
NT seq 3837 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagagacaacttcagcaaatggctttatcacactcatgacaaatatccaagac
tttctgagtgaggctcatacactgactgaaaggacaactcgtgaattggaaatgagtggt
acaaaacaaacgatgagaaaagtgagtgattcgaattgggaagaaacacaaacacgtgcc
ttcacaaagtgggtcaattctcacctgaagaaacgtgaaggtattgctcttgttgagaat
ttaatcaatgatgttcaaactggtgttccaatttttgttctttatgaaattatcagtggt
gaaaaacttggtaaaatgtacaacaatcctgagagtaaatttcacaagattgccaatttg
aatatagtcattgatcgtatcaatcaagttgtggaaacaatgggtattaaattgcaattc
tcagctgaacaagttttcaatggagaaaagagacaaatcttgggtttaatttggacttta
attttgagatttcaaattacaaaaactttggaaattgaacaacctattgttaaagttgat
actcctccagtgaaagtggaaagtaatgaagaacacaaggaagcagtgccagttgtcgaa
cctgtgaaacaacaacatacaacaaaacctcaaaagaagacaaatgctggtgatagtgct
aaaatggaattattaaaatgggtccaagaaaaattggttccatatgctggtgagttcctt
gtaaaggatttcacatcaagttggcaagatggtaaggcacttgctgctttgattagtact
ttgaaaccaagagcactcaaatataaaaagattgattttgtaaatactacaccattggaa
attaacagagaatcaattagaattgctgaagaagaattggatattcctgaaattattgat
cctgaggacattactgattcaccagaagaactctcattaatgacctatatttcctatttc
agagattatgacagacttcatccagaagaacaaattgaagaagaggaagttcctgaggaa
ccagttgtggaaattattgaagatattcgtccagaaattgatccatcaaaatgtattgct
gaaggtccagcttttgatgaatcaaatccaccaattccaggtcaaccaactcatttcaca
attgtcacctatgatgaagaagggaacaaatatattccaaagagtactgaagatgatgaa
aatcaaattactgtcaacttattcagtccatacgtttccgaagaaattccagaacctgac
attaagaataatggtgatggtacctatgatgtttcatttgtagttccagttggagctaag
gatttgaaggcacttattgttgtcaatggtgaaagtattcaaggtactcctcactctgtt
ccaaatgcttcaatctttgatcctgccaagagtattgttgttggtgaaggcgttcaacct
tataatttatatgttgacgaaattactgactttgttgtggaatgtagagatactaatgga
gctaacattttacaaagtgttccagatttgcaatttgatcttgtcttgaaggatactgat
actggtaatgagtacccagttaaagctcaacaagttgacaatgctgatggtacatataca
atcagctatgttcctgattgcccatctggttcttatgaactctctgttttgacaaacaaa
ggagaaaaagtaggaaattctccatttgatgttaccttccaacaaaaagtcatgccagca
caatgcgttgccaaaggtaatggtattttgcctttcggtttaaagactggtgttgccact
agtttcacaattgaaattaatgataagaatggtaaaattattccatatgccgatgaagaa
attttagttgatattttgagtggagatgaacttgttgaaccaagtgactatttcttaact
gttaccaataatcaaaatggtacctatactgttaattacaaaccaaagaaagctggaact
cacttcatttctgtaaagtgtaatgatgaaaatatttcacaaagtccattcaaggtagaa
atttcaactcttccttctgctccaaactctaaactcaaacttgtttcagttaaatcattg
ccaaacttgattgaacaagaaattgaccttaaggctctcgactcatttggtgttaaaaca
gcaaagaattgcaagttggttgccttagttgaagatgatgatggaaatctcattccagca
actattgttccaggtgaagatgataaactcaaggttgtcttcaagccaaccaaagctgga
caaaagtacaagaccaagattctcatggatggcgttccagttggtgatagtttcactgtt
caacacaaaccaattttatcttgtcctttgacaagagttttcggtcctggattgaatgga
gctgatttattctccaaggatagcgttcctgccatgttcaagatcaaatcaattgacaat
aatcgtaatccataccttcaatcaaacttgcaaccagtcaaggcctcagcaaagaaactc
aagagacttgccaaaagtattttcaaagaaccagattattttacagatttgttgaatcca
caatatgatttacaattagatgatgaatcagtagttgaatctattgacttttctaaatca
gttgatcttgatgaagttagaccagcattggaaagacacatcaaggcaacacctttcaag
gttattgttaaaaatgaaaacactggagaagatattccagctattgttttcaatacagcc
ccagccgaatatacagtcttttacaatccaactacggctggccctatttctattagtgtt
gttgataagaaagatcaacatccagttgctgacagcccataccaagctttcgttactgaa
ggagtcaacccaatgctttgccaagttaagggtccagcattgttgaaggcttacaaggga
agaccaacctatctcactattcttccaagagatgccaacaattcaccaatttctgttggt
ggacacgaattttatgccaatcttgctgataataatggagtttcatgtattgtaccacta
acaattgtagataataataatggtacctatgatgttaaattcactcctcaagctaaggga
aaacatttgatttcaatcaagcatgatggccaagatctcaaagattcaccatttccaatc
tttgtcagagatgatgagtttgctccatatgccaagaattgtcaagtatttgacaatcca
tccaagatgaagactaccaaaccacgtcacttctttgtacaaatgaaggataaggataat
aatccaattctctctggtggtgatcctctcaaggccacgctcaagacacctgaaggaaag
ctcgttcaacaccttgcagtcattgatccaaacactggtaaatataagattccactcaat
cctaaggttccaggtaaatatattgtaacttgttcactgggtgatgaagaagatggaggt
gaagtcatttcaggttctccattccatctcaatgttacacctggcatttcaccattgaag
actgaaattggtgattgggaatttgacattcaaacagctcaagacaatgaaccagaggac
ttattcatcaagattaaatcaccatctggaaaagtcatctcaccaaccatcatcaagtgt
ccaagacctgaaaatcatcaaccaaatgatgatgacgaatactcgaaaggagacagattc
aaacttattatcagaactacagaagttgaaaagggagactacttgatctatgctaatatt
tgtggatacccagtaaagggatcaccattcaagcaaactctagatgttagatgttaa

DBGET integrated database retrieval system