KEGG   Naegleria gruberi: NAEGRDRAFT_80125Help
Entry
NAEGRDRAFT_80125  CDS       T01241                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ngr  Naegleria gruberi
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NAEGRDRAFT_80125
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NAEGRDRAFT_80125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 348 aa AA seqDB search
MIASSPSGANIGESAFDGFTQEQGVAIVGSSNVDLTYGVKRIPKVGETLFADSFDQQFGG
KGANQAVCISKLSSKEAKVVFVTVVGNDAFGQQGKENFRTNNLYNVDKNVRIVDSVSGQA
LIFVEKATGNNSIVLVGGSNEHLTPQMVDDSWDDIKQCKVLVCQNETPLNATYHALKRGK
EEGLITIFNPAPAVNLLTLPPELADLPKYVDYIIPNETEAPLIIGKELADSYVEDQSSVE
SLCREIKEKLSVSNVIITLGKRGCAALYTENGETIYKYVEGEIVDVMDSTGAGDAWVGSF
AYFVSCDIPVEESIKLANFIASVTVQFKGAQMSYNAISQSTVLKKFEL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcttcctctccttctggtgccaatattggtgagtctgcctttgatgggtttaca
caagaacaaggtgtcgctattgttggtagttccaacgttgatcttacttatggagtaaaa
agaattcctaaagtcggtgaaacactttttgctgatagttttgaccaacaatttggtgga
aaaggagctaatcaagcagtctgtatttctaaattatcgagcaaggaggctaaagtagtt
tttgttactgttgttggtaatgatgcttttggccaacaaggcaaagaaaactttagaact
aataatttatataatgtggacaaaaatgtaagaattgttgattctgtgagtggacaagct
ttgatttttgttgaaaaagcaacaggaaataattcaattgttcttgtaggaggatcaaac
gaacatcttactccacaaatggttgatgactcatgggatgatatcaaacaatgtaaagta
cttgtatgtcaaaatgaaacacctctcaatgctacatatcatgctcttaagagaggaaag
gaagaaggattgattaccatttttaatccagctcctgctgtcaatctcttaactttacct
cctgaacttgctgatcttccaaaatatgtggattatattattccaaatgaaacagaagca
cctttaattattggaaaggaattggctgactcctatgttgaggatcaaagctcagttgaa
agcttatgtagagaaatcaaagaaaaattatcagtctcaaatgtcataataactttaggc
aagagaggttgcgctgctttgtacactgaaaatggagaaacaatctataagtatgtggag
ggtgaaattgtagatgtaatggattcaactggtgcaggtgatgcttgggttggaagtttt
gcttatttcgtttcttgtgatattccagtggaagaatccatcaagttggctaatttcatt
gcttctgtcactgttcaatttaagggagctcaaatgtcatataatgcaatttctcagtca
actgttttgaagaaatttgaactgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system