KEGG   Naegleria gruberi: NAEGRDRAFT_80134Help
Entry
NAEGRDRAFT_80134  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K11131  
H/ACA ribonucleoprotein complex subunit 4 [EC:5.4.99.-]
Organism
ngr  Naegleria gruberi
Pathway
Ribosome biogenesis in eukaryotes
Module
H/ACA ribonucleoprotein complex
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:ngr03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 490 aa AA seqDB search
MGKKDKKSSSTTEETSSKTLPTNLDVSKTDSSEFPLLLKNFDKLNARTGHYTPIPAGNTP
TKRKLEEYLKYGVINLDKPANPSSHEIVAWVKKILDVEKTGHSGTLDPKVTGCLIVCLNR
ATRLVKSQQGAGKQYVSILKLNGEVQGGYKAVEEALTTLTGAVFQMPPEISAVKRQLRIR
SIYDVKLFEFDAKSQMAVFWVKCQAGTYVRTLCEHLGLLLGTGGSMFELRRVQSGSLSEK
DFLYTMHDVLDAQHELKAKGDESYLRRIVKPLEILLTNYKRVIVKDSAVNSICFGAQLMI
PGVLRYDDSIETGEEIVLITTKGEAIATAYAVMTSIQIQSMDYGVVCKTKRVIMDRNTYP
RRWGMGPVSKLKKELIEQGKLDKYGQPTESTPEVWLNNYRDVSANKWFFLQKPEINAALG
KKSERQEAMDQLKPKSGSKKIETVAETKSKKIDLKPKKVEAEEEEEKKRKRKEESSDDES
SSSSSSFIGF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaaagataaaaaatcatcttcaacaactgaagaaacatcatctaaaactctc
ccaacaaatttggatgttagcaagactgattctagcgaattcccactcttgttgaaaaat
ttcgataaattgaacgctagaactggacattacactccaattccagctggtaacacacca
acaaaaagaaaattagaagaatatcttaaatatggtgttatcaatttggacaaaccagct
aatccatcttcccacgaaattgttgcttgggttaagaaaattctcgatgttgaaaagact
ggccattctggtactttggatcctaaagttactggttgtttgattgtttgtttgaatcgt
gcaactcgtttggttaaatcccaacaaggtgctggtaaacaatacgtttctatcttgaaa
ttaaacggagaagttcaaggaggatataaggctgttgaagaagcattgactacattgact
ggtgctgttttccaaatgccaccagaaatttctgctgttaagagacaattgcgtattaga
tctatttatgatgttaaacttttcgaatttgatgctaagagtcaaatggctgttttctgg
gttaaatgtcaagccggaacctacgtcagaaccttgtgtgaacatttaggtttattattg
ggtactggtggttctatgtttgaattgagaagagttcaatctggttctttgagtgaaaag
gatttcctctacactatgcatgatgttttggatgctcaacatgaattgaaggccaagggt
gatgaatcttatttgagacgtattgttaaaccattggaaattttgttgaccaactataag
cgtgttattgttaaggatagtgctgttaactcaatttgtttcggtgctcaattgatgatt
cctggtgttttacgttatgatgattctattgaaactggtgaagaaattgttttgattacc
acaaagggtgaagctattgctactgcttatgctgtcatgacctcaattcaaattcaatct
atggattatggtgttgtttgtaagactaagagagttattatggatcgtaatacctatcca
agacgttggggtatgggtccagtttccaagctcaagaaggaactcattgaacaaggtaaa
ttggataagtatggtcaaccaactgaatctacacctgaagtctggttgaacaattatcgt
gatgtttctgctaataagtggttcttcttacaaaagccagaaattaacgctgctctcgga
aagaagagtgaaagacaagaagctatggatcaactcaagccaaagagtggaagcaagaag
attgaaactgttgctgaaacaaagagcaagaagattgacttgaagccaaagaaggttgaa
gctgaagaagaagaagaaaagaagagaaagagaaaggaagaatcatctgatgatgaaagt
tcttcatcctcatcatctttcatcggattctga

DBGET integrated database retrieval system