KEGG   Naegleria gruberi: NAEGRDRAFT_80172Help
Entry
NAEGRDRAFT_80172  CDS       T01241                                 

Definition
ubiquitin carboxyl-terminal peptidase
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
ngr  Naegleria gruberi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 719 aa AA seqDB search
MSENFWEQRKLEIEQTRQAELEKKAAEQKEKKKSQVVEKTEKKKEKQPKKVEQQKEQTQQ
QPNGAAAASEQKEKKKKNFKKNKEASQPSTSQPATTEASAQDDFQTVERKTGGRRQFRGA
NKRSNNKKKENGEKKKENKENKEQQPKKEEKTTTEQGQQQVVVQPVQIKVFSTTESTPVQ
GSDSWVSLLRGNQPESTSTTQQQQPTSNGAATSTKKSKPKSEKKTVVAKPVTAEKTTTEA
KNKPQKNYESGKNLLRSTEVEVDQALLDEVGVFIQPRGMTNINNSCYMNAVLQTLVSLPQ
FYHVMKRLGKISLDNEEYPLTNKFVRLVNEYQTMKTHRPQSGKEGEKKDRKYFINASTEH
LVPSYIVDYIQQSSTNLEDAFLLGTQHDAHEFLNHILQRLHEELKKTEATLGRKSPSASK
KKSNKKQEATSEQAEQPSTETTSEEWKEVGKKNKANPMREHEMGDSSVIARTFAGKMKSF
VQKQGESKGSSVVEPFFSLHLPIKDENIKGVKFALREMTKEENVSDKNAKSSIYQLPKVL
LLHLRRFDFSSTEGVQKISKRIRFDYELNIDEKVVPNVKAISGRPSLKYRLASVICHHGK
DATSGHYSTYIQHGCGKWIHIDDTKVTVVSLQHVLDQQAYILTYVQDDNQEHYKLYSEGS
SSSPLFSESSEQNGEKKKDHKKKDKKDKKEKKSKPATTTTTTTTTPTTTETKTEAKTDV
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaacttttgggaacaacgtaaactcgaaattgagcaaactaggcaagctgaa
ctcgaaaagaaggctgctgaacaaaaggaaaagaagaagagtcaagtagtagaaaaaact
gaaaagaagaaggaaaagcaaccaaagaaggttgaacaacaaaaggaacaaacccaacaa
caaccaaacggtgctgctgctgcttctgaacaaaaagaaaagaaaaagaagaactttaaa
aagaacaaggaagcctctcaaccatcaacttcccaaccagccactactgaagcttctgct
caagatgatttccaaactgtagaaagaaagactggtggaagaagacaattccgtggtgct
aacaagagaagtaacaataagaagaaggaaaatggcgaaaagaagaaggaaaataaggaa
aataaggaacaacaaccaaagaaggaagaaaagacaacaactgaacaaggacaacaacaa
gttgttgttcaacctgttcaaattaaggtcttttctaccactgaatcaacacctgttcaa
ggttctgactcttgggtttctctcttgagaggtaatcaaccagaaagtacctccactact
caacaacaacaaccaacttctaatggtgctgctacttctaccaagaagagtaagccaaaa
tccgaaaagaagactgttgttgccaagccagttactgctgaaaagacaacaactgaagca
aagaacaagccacaaaagaattatgaatccggaaagaacttgttgagatcaactgaagtt
gaagttgatcaagcattgttggacgaagttggtgtttttattcaaccaagaggaatgacc
aatattaacaattcttgttatatgaatgctgttttgcaaactttggtctcccttccacaa
ttctatcatgtaatgaagagactcggaaagatttctctcgacaatgaagaatatccactt
accaacaagtttgtccgtttggttaacgaatatcaaaccatgaagactcaccgtccacaa
agtggaaaggaaggtgaaaagaaagatagaaaatactttatcaatgcttctactgaacat
ttagttccaagttatattgttgattatattcaacaatcatcaaccaacttggaagatgcc
ttcctcttgggtactcaacatgatgctcacgaattcttgaatcacatcttgcaaagactt
cacgaagaattgaagaagactgaagctactttgggtagaaagtctccttctgcttcaaag
aagaagagcaataagaagcaagaagcaacttctgaacaagcagaacaaccatccactgaa
actaccagtgaagaatggaaggaagttggaaagaagaataaggccaatccaatgcgtgaa
catgaaatgggtgatagcagtgttattgctcgtactttcgctggtaagatgaagagcttt
gttcaaaagcaaggtgaaagcaagggaagttctgttgttgaaccattctttagcttgcat
ttgccaatcaaggatgaaaacatcaagggtgttaaattcgccttgagagaaatgaccaag
gaagaaaatgttagtgataagaatgccaagtcttctatttatcaacttccaaaggttctc
ctcttacatttgagaagattcgacttttcttcaactgaaggagttcaaaagatttctaag
cgtattagatttgattatgaattgaatattgacgaaaaggttgttccaaacgtcaaggcc
atttctggaagaccaagtttgaaatatagacttgctagtgtcatttgtcatcatggaaag
gatgctactagtggacattatagtacttatattcaacatggatgcggaaagtggattcat
attgatgatactaaggtaactgttgttagtttgcaacatgttctagatcaacaagcttac
attttgacctatgttcaagatgataaccaagaacactataaattatactcggaaggaagc
tcatcgtctcctttgttcagtgaatcaagtgaacaaaatggtgaaaagaagaaggaccac
aagaagaaggataagaaggacaagaaggaaaagaaatctaaacctgccacaactactacc
actactactactaccccaactactaccgagacaaagacagaagctaagaccgatgtgtag

DBGET integrated database retrieval system