KEGG   Naegleria gruberi: NAEGRDRAFT_80401Help
Entry
NAEGRDRAFT_80401  CDS       T01241                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ngr  Naegleria gruberi
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NAEGRDRAFT_80401
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    NAEGRDRAFT_80401
Enzymes [BR:ngr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     NAEGRDRAFT_80401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 293 aa AA seqDB search
MLKIPQPQQEYNNQGVALEQHPPNNRTNSLSSQNVGIKFLQTSNKTLVETKIQVSLESLV
KLDDNTVKNILYEMANSNLSIENSSIENFALITSKHFFREFDNINLVKLDVEQSNWQQIE
NNKAGHFQAECLRFVRLADPRNGEISLCSGVKSLSVPKKSEVSEFLKSNSIKMDVFWKIS
SSGIEEHTRSLVNDRQSVIDFNETYDKVRESIWNGVKDIQNIDLKDQCNNVLGDVPIIKC
VFISIPNCGQKMDAFASRHQSVTQQFSFHGRPANNIFLNHFHRMNRDFYASKL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaatcccacaaccacaacaagaatataacaaccaaggagtagcattagaacaa
cacccacctaataatcgtacaaatagtttaagtagtcaaaatgtcggaattaagtttttg
caaacaagtaacaagaccttagttgagaccaagattcaagtctctttggagagtctcgta
aaattggatgataatactgtaaagaatattctttacgaaatggcaaactcaaatttgagt
attgaaaattcttctattgagaattttgcattgattacttcaaagcactttttcagagaa
tttgataatattaatcttgtaaagttggacgttgaacaatctaattggcaacaaatcgaa
aacaacaaggctggacatttccaagctgaatgtctcagatttgttcgtctcgctgatcca
agaaatggtgaaatttccctttgtagtggagttaaatctttgagtgttccaaagaaatct
gaagtatcagaattcttgaagagtaattctatcaagatggacgttttctggaagatttcc
tcaagtggcattgaagaacatacaagaagcttggttaatgataggcaatctgttattgac
tttaatgaaacctatgataaggttagagaatctatttggaatggtgtaaaggacattcaa
aacattgacttgaaggatcaatgtaacaatgtattgggagatgtaccaataattaagtgt
gtctttatctcaatcccaaattgtggacaaaagatggatgcatttgcttctagacatcaa
tctgttactcaacaattctcattccatggtcgtccagccaataatattttcctcaaccac
ttccatagaatgaacagagatttttatgcttccaagctctaa

DBGET integrated database retrieval system