KEGG   Naegleria gruberi: NAEGRDRAFT_80526Help
Entry
NAEGRDRAFT_80526  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ngr  Naegleria gruberi
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 1342 aa AA seqDB search
MIPNDYEENSRRRTNQDDDNDDIDNDEPNNQQQNDDEENFENEPKYAQSGRSTLGGDYYD
DGYSQNNQGLSTPSMNNVSPSSNTSISPPFGQSSDGLASFRLTKSRRRKSTNLPNKPLFF
TSDRHQVFTPVPREVIDWRMKQRLKTVHVALVVCLNIGVDPPDVVKVQPCAKLECWVDPQ
THPQKALEAIGSNLKLQYERWQPRARYKQCLDPTVEDVKKTCVQLRKSAKKERILFHYNG
HGVPKPTTNGEIWVFNKTFTQYIPLSLYDLYCWMDSPSIYVFDCSNAGIILNSFIQIIEQ
KDAPPRGSVMKKENIILAACGVKENLPMNPEYPADLFTSCLTTPIKIALRWFRQRNKLVS
GVTDDLIENIPGRINDRRTPLGELNWIFTAVTDTIAWNVLPRDLFHKLFRQDLLVASLFR
NFLLADRIMRSANCTPVSYPKLPETHNHPMWDAWDLALDQCVSQLPNLFNNPSAEYQYNP
FFSAQLTDFQVWLEFGHRIQKPPTQLPILLQVLLSQSHRLRALTLLGRFLDMGSWAVNLA
LSVGIFPYVLKLLQSNSVELRRILVFIWTKILALDKPCQIDLVKDHGHSYFINVLVERNN
DTELRAMSCFVLSVIADRFNPGQQACLKYKNLFDLCSSQLTEQDPILRKWACLLIAKLVE
DFDEGQELAIKSTTHEKVLRLLNDDVPEVRAASIFTLQKFVGNKPEKSEERVQGEIKICT
ALYQTILDGSPMVRKELVYALGTFIQQYGEFIAPELLKSIIKEETHYLNNAPTPILVSGS
NSSSPNTLIFQQKKKKKKERKPVDEVTTQPSTPKDARVLKDMKDRELGQLSYFALDVCRV
AIMLCFDPVREVAEEAHKILSFMRYTYSKLNDEDFERELFLIKEKAFNNTQNTPKSPAKP
MQKRLIDKLSMRRSASDSDFLKAGFVNQQSNYSDEDTDSDSLDVTSSSNSNMIFMKSNFY
ERSCEYFSNPILTENSPKDDSFVSQQVLKRRKRNEHLVKEANTMLKVAGKKKLEEQIGFF
GNESEICSQMKFHGFEPYLVVSDENDGLSVWNWVRGAIVNQFRCGDILKSRITDFHIINE
EAEQSMLLVASAAGNVAIYKNYEKKEEPVSSFRAAHEALSSDSGLGILTEWQQHNGTLYV
TGDIEKVKIWDVDKEYCVQNIPLDVPVTSIAADPNNGYLFAAGCSDGKVLLFDKRESPNS
GPVLTHQLISNYEEVSKNWVVSAKIQNVNSNQVITGYSSGDIMFWDTRVTNKCTRQFNAH
KGSMTALAIHNYAPVLACGSNNQFIKVFNTSGETLSMIYYHDGFLGQRIGPISCLAFHPF
RMCLAAGSTDSIISLYSGDTKK
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atgattccaaacgattatgaagaaaactccagaaggagaacaaatcaagatgacgataat
gatgatatcgataatgatgaaccaaacaatcaacaacaaaatgatgatgaagaaaacttt
gaaaatgagccaaaatatgctcaatcaggaagatcaactctaggaggggattattatgat
gatggttactctcaaaataatcaaggtctttcaactccgagtatgaacaatgtttctcct
tcatcaaacacatctatttctccaccatttggtcaaagttctgatggtttagcttcgttt
agattgacaaaatctagaagaagaaaatctactaaccttccaaacaagcctctctttttc
acaagtgatagacatcaagtttttactccagtacctagagaagttatagattggagaatg
aaacaaagattaaaaactgttcacgttgcacttgttgtttgtttgaatattggagttgat
cctccagatgttgtcaaggttcaaccttgtgcaaagttggagtgttgggttgatcctcaa
actcatccacaaaaggctttggaagctattggtagtaatttgaaattacaatatgaacgt
tggcaaccaagagcaagatataagcaatgtcttgatcctactgttgaagatgttaaaaaa
acttgtgtacagttaagaaaaagtgctaaaaaggagagaatactgttccattacaatggt
cacggtgttccaaaaccaacaacaaatggtgaaatttgggttttcaataagacctttact
cagtatattccattgtcactttatgatctgtattgttggatggattctccttcaatttat
gtttttgattgctctaatgccggaataattttgaatagttttattcaaattattgaacaa
aaagatgctcctccaagaggaagtgtcatgaagaaggaaaatattattttagcagcttgt
ggagttaaagaaaatttaccaatgaatcctgaatacccagctgatttattcacatcatgt
cttactacacctatcaaaattgcattgagatggtttagacaacgtaataagctcgtttct
ggagttactgatgacttgatagaaaatattccaggtagaatcaatgacagaagaacacct
cttggtgaattgaattggatctttactgcagttactgatactattgcttggaatgtttta
ccaagagatttattccacaaacttttcagacaagatcttcttgttgctagtttgtttaga
aatttcttgttggctgatagaattatgagatcagctaattgtacaccagtaagctatcct
aaattacctgaaacacacaaccatccaatgtgggatgcatgggatttggctcttgaccaa
tgtgtatcacaacttcctaacttatttaacaatccaagtgctgaatatcaatataaccca
ttcttctctgcacaacttacagatttccaagtttggttggaatttggtcatagaattcaa
aaaccaccaacacaactcccaatcttacttcaagttttactcagtcaaagccatcgtttg
agagctctcacattattgggaagatttttggatatgggaagctgggctgtaaacttggct
ctctctgttggtattttcccatacgttctcaaacttctccaaagtaactctgtagaactt
cgaagaattttagtatttatttggactaaaattttggcactcgacaaaccatgccaaatt
gatcttgtaaaggatcatggtcatagctatttcatcaatgtactagttgaaagaaataat
gatactgaattgagagcaatgtcttgctttgttttatcagttattgcagatagatttaat
cctggccaacaagcatgtctcaaatataagaacttgtttgatctttgctcctctcaattg
actgaacaagatccaattcttagaaagtgggcatgtctcttgattgcaaagctcgttgaa
gattttgatgaaggtcaagaattggctatcaaatctactactcatgaaaaagttttaaga
cttttaaatgatgatgtaccagaagttagagcagcaagtattttcactcttcaaaagttt
gttggaaataagccagaaaaatccgaagaaagagtacaaggagaaatcaagatttgcact
gctctttatcaaacaattttggatggttctccaatggttagaaaggagctagtttatgct
cttggtacatttattcaacaatatggcgaatttattgcaccagaacttttgaaatccata
attaaggaagaaactcactacctcaacaatgccccaacaccaattttggtttctggttca
aactcatcatcacctaatactttaatattccaacaaaagaagaagaaaaagaaggaaaga
aaacctgttgatgaagttaccactcaaccttccactccaaaggatgcccgagttctcaaa
gatatgaaggatagagagcttggtcaactttcatattttgctcttgacgtttgtagagtg
gctattatgttgtgttttgatcctgttcgcgaagttgccgaagaagcccacaagattctg
agctttatgaggtatacttactcaaaattgaacgatgaagatttcgaaagagaactcttc
ctcatcaaagaaaaggcattcaataatactcaaaatactccaaagagtccagccaagcca
atgcaaaagagattgattgacaaattatcaatgagaagaagcgctagtgattctgacttt
ttgaaagccggatttgttaatcaacaaagcaattattctgatgaagatactgactctgac
agcttggatgtcacctcttcttctaacagtaatatgatattcatgaaatcaaacttttat
gaaagaagttgtgaatatttttcaaatccaattcttaccgagaattcaccaaaggatgac
agctttgtatcccaacaagttcttaagagaagaaagagaaacgagcatttggttaaggaa
gccaatacaatgctcaaggttgctggtaaaaagaagttggaagaacaaattggtttcttt
ggaaatgaaagtgaaatttgttctcaaatgaaattccatggatttgaaccatatttagta
gtttctgatgagaatgatggtttaagtgtttggaattgggttagaggtgctattgtgaat
caatttagatgtggtgacattctcaagagtagaattacagatttccatatcattaacgaa
gaggcagagcaatccatgttgttggttgcatcagcagctggtaatgttgcaatctataag
aattatgaaaagaaagaagagccagtatcttctttccgagctgctcatgaagccctcagc
agtgattcaggtctgggaattttaacagaatggcaacaacacaatggtacactttatgtc
actggtgatattgaaaaagtcaagatttgggatgtcgataaggaatattgtgttcaaaat
attcctctggatgttccagttacgagtattgcggctgatccaaataatggatatctcttt
gctgctggttgtagtgatggtaaagttctcttattcgacaagagagaatcaccaaatagt
ggaccagtacttactcaccaacttatttcaaattatgaagaagtcagtaagaattgggta
gtaagtgccaagattcaaaatgtcaatagcaatcaagttatcactggttattctagtggt
gatatcatgttctgggatactagagttactaacaaatgcacaagacaattcaacgctcat
aagggatcgatgacagcattagccatccataattatgctcctgtattggcttgtggtagc
aataaccaattcatcaaagttttcaacacatcaggtgaaacattaagcatgatttattat
catgacggatttttaggtcaaagaattggtccaatttcatgtcttgcattccatcctttc
agaatgtgtttagcagctggatcaaccgattctatcatctccctctattctggtgatact
aagaaataa

DBGET integrated database retrieval system