KEGG   Naegleria gruberi: NAEGRDRAFT_80599Help
Entry
NAEGRDRAFT_80599  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ngr  Naegleria gruberi
Brite
Protein kinases [BR:ngr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   NAEGRDRAFT_80599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 2244 aa AA seqDB search
MVAKTFGKLARASESKTLTAEWVEFEIKRALEWLESDNNNNKKNDDGKRYAAVFILKELA
ENAPTLFYGHVQSFLSVIWNGLTDPNVSVRIGSVQALHAVLGLISERPTNFRNIWYQDIY
NQTNINFKNAKSDVVHGALLAIGELLGFAGNVLKDEFDAICNTVLGFHSHKDKMVRRTVI
ELIPVLAKFYGERFNEKYLHRSINLILEAIKNGFERPSSFLALGELTTRVGQPIKKYVDD
IFNIITEWGLKIKKKNFCEESLTCISDISKAVGDTVSLRILHLLPSMFAGGLTTTLIQSL
TIISKEIPALLQPIQKRVLDTISQILARQPFNTLNPVTPPTQFAPHIESTLYSTPTIVFA
LKTLGSFNVKGHNLIDFVHDCVVKYLDDDIPSVRKEAAKTCCRLLVSQGKPPVKGHFGSV
VGDVLAKLLIVGITDTDYTIRFAVLSSLDPKFDHYLALSDNLRSLFIALNDEFFEIREVA
ISVIGRLSIRNPAFVLPSLRKALLQLLTELEYSQDSRSKEESARMLGHLIVAAPRLIKPY
VSSVLKVLMERIKDNNPNVASCVLDTTGKLAEVGGMDIADFIDDLLPSVIETLQDQSSSA
KRAMAVKTLGQIVASTGYVITPYIKYPNLLTLLLAILKSEEEWTTRREIIKVLGIIGAID
PYQHKLQLESAKETNDSSDIIPGLSPSSEEYYPTVAFNALIRILTDPSLAIHHLNAIQAV
MFIFTSLNMKCVPFLPQVMPPFLNLIRNCEPNIRNTVFQQLSLLVSIVKQHIRNYLDEIF
LLIHEFWDMSSSDTDFKEQIISLEEEICTALNEQFKPNLPDVIPQILSVLQTPQQFKPAK
KALHALIVFGRHLEEYLYLVIPTVVKLFEAPLANISLKREAIRCIGKLSRILNFSEYSSR
IIHPLSRVLKIPNNEIRQEAMDTLCNIIHQLGSDFSIFIPMVTKVLTQYNITHQKYNEFI
FHLLKGLPLPNMPDDEDEVSNSNGEDSMTEVKKMVINQNSLRKAWEASQRATKDDWIEWN
RGFSVELLKESPSPALRSCSALAQVYHPLTRELFNAGFVSCWSELDDKAQNEVVRALEMA
FSSPDLPPEVLQTLLNLAEFMEHDENPLPIAISALGALAEKCQCFAKALHYKEIEFQQNP
SALIEDLISINNQLQQHEAAMGILKYAQKNHSIELKESWYEKLQRWKEAYDAYSIKQKQN
PYDQSLTLGKMRCLKAIGEWEKLFKLCQESWNTFSDTIKEEMAPMAAHAAWNLGEWESMR
NYVNILSEDTSEGAFFRAILAIHQKDHHNAEVLIDKTRKVLDTELAALVGESYNRAYDII
VTVQQLSEMEEIIRYQKAEDEETKALTHQIWIDRLHGCKRNVEHWQNILSVRKLVIPERQ
DLSTWLKFASICRKSNKIRMSEKILQKLVDGISLSEEPEKLLISPEVHPKISYEYFKHMW
VEGKQMRAYELMNQFVYNIQCDNQLKARAFLTLGQWQKVIYRQHGGLEESKLPQILSHFK
AATDFDKEWYKAWHEWALLNSEVVSHFEKKSQPSSRNMEAMTIYLISALTGFFNSINLSP
DRNSSLQDILRLLTLWFKHGAMKEIEKTLVDGFNTVSIDTWLEVIPQIIARVNSHVGPVR
KLIHKLLSKVGKVHPQALVYPLTVCSYSQSLSRKKAAESLLNYMRQNNPVLAEQALMVSH
ELIRVAILWNELWHEGLQEASRLYFGEHNVPGMLNTLKPLHEMIQNPETLSEIAFAQGFG
RDLQDAWEFCKKYQRTKKEKELSQAWDLYYHVFRRIDKQLPHMMKLELQIVSPKLLEAND
LELAIPGTYKSGQPVIRIANFARQLRVISSKQRPRKLKIFGSDGNEYQFLLKGHEDLRQD
ERVMQLFGLVNTLLKNDPETSTRDLSIKRYAVIPLSSNAGLIGWVDNCDTLHALIKEFRD
SRNVLLNIEHRLMQQVAFDYENLTLMQKIEVFEYALENTTGQDLYKVLWLKSRNSEVWLE
RRTNYTRSLAVMSIVGYILGLGDRHPSNLMLEKSTGKIVHIDFGDCFEVAMHRDKFPEKV
PFRLTRMLINAMEVCGIEGTFKSTCESVMRVLRENKDSVMAMLEAFVHDPLINWRLLETQ
NDEDNTQESSMQNIANNMQQDSDMGLRSNNEGSPQTVSSYTDHDSVHYPSRSLREKNLRR
SLQSDETEEESLKQPEALNQRALSVSSRIESKLLGRDFVDEDEDDQIEDEPHTLNCSEQV
ELLIEQATSNSNLCQMYIGWCAFW
NT seq 6735 nt NT seq  +upstreamnt  +downstreamnt
atggttgccaaaacttttggtaaattagccagagcaagtgaatctaaaactttaacagca
gaatgggttgaatttgaaattaagagagctttggaatggttggaaagtgataacaataac
aacaagaaaaatgatgacggaaaacgatatgcagcagtgtttattctaaaagaacttgct
gaaaatgctcctacactattttatggacatgtacaaagctttttgagtgtgatttggaat
ggactcactgatccaaacgtaagtgttagaattggttcagtgcaagcacttcatgctgtt
cttggtttaatatcagaacgtccaacaaatttccgtaatatttggtatcaagatatttat
aatcagacaaatatcaactttaagaatgctaaatctgatgttgttcacggagctttactt
gccattggtgaattattaggatttgcaggaaatgtcttgaaagatgaatttgatgccatc
tgtaatacagttcttggattccactcacataaagataaaatggtcagaagaactgtcatt
gagcttatacccgtattggcaaagttttacggagaaagatttaatgagaaatacttacat
agatcaattaatttgatattagaagctatcaaaaacgggttcgaaagaccttcatcattt
cttgctcttggtgaattaacaacacgtgttggacaacctatcaagaaatatgtggatgac
attttcaacataataacagaatggggtcttaaaatcaaaaagaagaacttttgcgaggaa
tctttaacatgtattagtgatatttcaaaagctgttggtgatacagtttctctccgtatt
ttacatttacttccttccatgtttgctggtggcttaaccacaacacttatccaatccctt
acaattatctccaaagaaatccctgcactcttacaacctattcaaaagagagttttggac
acaatttctcaaattttggctagacaaccatttaatacccttaatccagtcacacctcca
acccaatttgctccacatattgaatctacactttatagtacaccaacaatagtttttgct
cttaaaactttgggaagtttcaatgtcaagggacacaacttgatagattttgtacatgat
tgtgttgtaaaatatttggatgatgatataccttctgttagaaaagaggctgctaaaaca
tgttgcagacttcttgtcagtcaaggaaaaccaccagttaaaggtcattttggttctgtt
gttggtgatgttttagcaaaacttttaattgttggtattacagatacagactacacaatt
agatttgctgttttatcttctttagatccaaagtttgatcattatttggcattatcagat
aatttgagatccttatttattgctcttaatgatgaatttttcgaaattagagaggttgct
atttctgttattggaagattgagcattagaaatcctgcatttgttcttccatctttaaga
aaggctcttctccaacttttgactgaacttgaatatagtcaagactctagaagcaaggaa
gaaagcgctagaatgcttggtcatttaatagttgcagctcctagattgataaaaccatat
gtttcgagcgtattgaaagttttaatggaaagaatcaaggacaataatccaaatgtagcc
tcttgtgtattggatacaacaggtaaacttgcagaagttggtggaatggatattgctgat
tttattgatgatcttttgccttctgtaattgaaactttacaagatcaaagttcttcagca
aagagagctatggctgtaaagactttaggacaaatagttgccagcactggttatgtaatc
actccctatatcaagtatcctaatttactgacacttttattagctattttaaagtcggaa
gaagaatggaccacaagaagagaaataatcaaagttcttggtattattggtgctattgat
ccatatcaacacaagctccaattggaatcagcaaaggaaactaacgacagcagcgacatt
attccaggtttaagcccttcttctgaagaatactatcctacagttgcatttaatgctctt
attagaattttgactgatccttctcttgccattcaccatcttaacgccatccaagcagtc
atgtttatctttaccagtttaaatatgaaatgtgttcctttcttacctcaagttatgcct
cctttcttgaacttgattagaaattgtgaacctaatattcgtaatactgttttccaacaa
ttaagtttgctagtttctattgttaagcagcatatcagaaactatttagacgagattttc
ctacttatccacgagttctgggatatgagttcttctgatactgatttcaaggaacaaatt
atttcactagaagaggaaatttgtacagcacttaatgagcaattcaaaccaaaccttcct
gatgttatccctcaaatattgagcgttcttcaaactcctcaacaatttaaaccagcaaag
aaagcacttcatgcacttattgtttttggtagacatttagaagaatatttatatctcgtt
attccaacagtggttaaattgttcgaagctccattggctaatatttctcttaagagagag
gctattagatgtattggtaaattgagtagaatcttgaacttctcagaatattcttcaaga
attattcatccactttctagagttctcaaaataccaaacaatgaaattagacaagaagct
atggatactctctgcaatattattcaccaattgggaagcgacttttctattttcattcca
atggttactaaagtgttaactcaatataatatcacacatcaaaagtataatgaattcata
ttccacttgttgaagggacttccacttcctaatatgcctgatgatgaagatgaagttagt
aattctaatggagaagactcaatgacagaggtcaagaaaatggttatcaaccaaaatagt
ttgagaaaggcatgggaagcatcccagagagcaaccaaggacgattggattgaatggaat
agaggtttttcagttgaacttttgaaagaatctccttctcctgcattacgttcatgttca
gcattagctcaagtctatcatccacttactagagaattatttaatgctggttttgtcagc
tgttggtctgaacttgatgataaggcacaaaatgaagttgtgcgtgctttggagatggca
ttctcttcccctgatttacctcctgaagttttgcaaacacttttgaacttggcagaattt
atggaacatgatgaaaatccacttcctattgctataagtgctcttggtgctttggctgaa
aaatgtcaatgttttgccaaggcattgcactataaggaaattgaattccaacaaaatcca
agtgctctcattgaagatttgattagtatcaataaccaactccaacaacatgaagccgct
atgggtattcttaaatatgctcaaaagaatcacagtattgaactcaaagaatcgtggtat
gaaaaacttcaaagatggaaggaagcttatgacgcctacagtatcaaacaaaagcaaaat
ccatatgaccaaagcctaactctaggtaagatgagatgtttgaaggctattggcgaatgg
gaaaagcttttcaagctttgccaagaatcatggaacactttcagtgatactatcaaagaa
gaaatggcaccaatggcagctcatgctgcttggaacttgggagaatgggaaagcatgaga
aattatgttaacattctcagcgaagatacaagtgaaggtgctttctttagagcaattttg
gctattcaccaaaaggatcatcataatgcagaggttttgattgataagactcgtaaagtt
ttggataccgaacttgcagcacttgttggtgaaagttacaatagagcctatgatattatt
gttaccgtccaacaattgtctgaaatggaagaaattattagatatcaaaaggctgaagat
gaagaaaccaaagctcttactcaccaaatatggattgacagacttcatggttgtaagaga
aatgttgaacattggcaaaacattctctcagttagaaaattagtaattcctgaaagacaa
gatctttcgacatggttgaagtttgcttctatttgcagaaagtctaacaagattagaatg
agtgaaaagattcttcaaaaattagttgatggaatttcattgagtgaagaaccagaaaag
cttctcatttctccagaagtacatccaaagatttcatatgaatatttcaaacacatgtgg
gttgaaggaaagcaaatgagagcttatgaattaatgaaccaatttgtatacaacattcaa
tgtgataaccaacttaaagctagagcattccttacattgggacaatggcaaaaggttatt
tacagacaacatggtggattagaagagagcaaattaccacaaattctttctcatttcaag
gctgccacagatttcgataaggaatggtacaaagcttggcacgaatgggctcttctcaac
tctgaagttgtttctcactttgaaaagaagtctcaaccttcttcaagaaatatggaagct
atgactatttatctcatctctgctcttactggctttttcaattctattaatctcagtcca
gatagaaactcaagcttgcaagatattttacgtttacttacattgtggttcaaacatggt
gctatgaaagaaattgaaaagactctggttgatggttttaatactgtttcaattgataca
tggctcgaagttattccgcaaattattgctcgtgttaactcccatgtgggtcctgttcgt
aaattgatccacaagcttttgtccaaggttggcaaagtacatcctcaagctttggtttat
ccattaacagtttgttcatactctcaatctttgtcaagaaagaaggctgctgaatccttg
cttaattacatgagacaaaataacccagttcttgccgaacaagctcttatggtcagtcat
gagttgattagagttgcaattttgtggaacgaattgtggcatgaaggacttcaagaagca
tctagattgtactttggcgaacacaacgtccctggcatgttaaataccttgaagccattg
catgaaatgattcaaaatccagagactttgagcgaaatcgcttttgcacaaggtttcggt
agagacctccaggatgcttgggaattctgtaaaaagtatcaaagaacaaagaaagaaaag
gaactttctcaagcttgggacctgtactatcatgtatttagaagaattgataagcaactt
ccacacatgatgaagcttgaattgcaaattgtttctccaaaattattggaagctaatgat
ttagaacttgccattcctggtacttacaagagtggacaaccagttattagaattgctaac
tttgctcgtcaattgagagttatatcttccaaacaaagaccaagaaaactcaagattttc
ggtagtgacggtaacgagtatcaattcttgttgaagggtcacgaagatttaagacaagac
gaaagagtaatgcaactcttcggtttggttaacaccttgctgaagaatgatcctgaaaca
tctactcgtgatcttagtattaagagatatgctgttattccactcagctctaatgctggt
ttgattggttgggttgacaattgtgatactcttcacgctcttatcaaggaattcagggat
agcagaaatgtactcttgaacattgaacatagactcatgcaacaagtcgcttttgattat
gaaaatttaactttaatgcaaaagattgaagtgtttgaatacgctcttgaaaataccaca
ggacaagatttgtacaaagtattgtggctcaagagtagaaactctgaagtctggcttgaa
agaagaactaactatacccgttcattggctgttatgtctattgttggttatattcttggt
cttggtgacagacaccctagtaacttgatgttggaaaagtcaactggtaaaattgttcac
attgactttggtgactgtttcgaagttgctatgcacagagataagttccctgaaaaggtt
cctttcagacttacaagaatgctcattaatgctatggaggtttgtggtattgaaggaaca
ttcaaatctacttgtgaaagtgtcatgagagtgttaagagaaaataaggattctgttatg
gccatgttagaagctttcgtccacgatcctttgatcaattggcgtttgcttgaaactcaa
aatgatgaagacaatactcaagaatcttccatgcaaaatattgcaaataatatgcaacaa
gactctgatatgggactcaggtcaaataatgaaggttctcctcaaactgtttcatcttac
accgaccacgatagtgtacattatccttctagatcacttcgtgagaagaatctccgaaga
tcattgcaaagtgatgaaactgaagaagaatcactcaaacaaccagaagctctcaaccaa
agagctttatctgtcagttcaagaattgaaagcaagcttttgggcagagattttgttgat
gaagatgaggatgaccaaattgaagatgagcctcacactttgaattgttctgaacaagtt
gaactcttaattgagcaagcaacatctaactctaatttatgtcaaatgtacatcggttgg
tgtgcattttggtaa

DBGET integrated database retrieval system