KEGG   Naegleria gruberi: NAEGRDRAFT_80903Help
Entry
NAEGRDRAFT_80903  CDS       T01241                                 

Definition
retinoblastoma protein
Orthology
K06618  
retinoblastoma-associated protein
Organism
ngr  Naegleria gruberi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 733 aa AA seqDB search
MVSLQFESTTCYSVLQKVQKKLVLCHCLFEKYQECFQEVITPNLQMDNFKAGWIILVLLA
RHLPSSLLDFTESVNLLINFMISMWKASQNSRLSETIEELFSICNISKDKLDSRYDEYIR
TTLSKLTIENLSDFVNNIDSLSKLNMLFDKDEDLTLGSLGFDERIFLYRNDINLIGDISK
ISSAPVYQLNPPKPTQHNDPFRSPLRSPGHFTATSQTPLQASLLVIQLIEESTKGLSSSP
DETLLGYFKSCNIDQTSTIENRLKSLVDKVNFESLLLFNKEKRKQEIMKIYYGTLKHMLQ
GEEKRLSGTANFSTLLTNENFHRSLTICSIECVSFAYNSKDTIDLQVLLNEFVLEPFELS
IVLESFVQNATWLNSALKRQFKSIEEVLLDSLAWKKNSVLYSKLSTSVVPQPPKPGNETP
NRNSNIESFGMYSPMASRKQQPQSAPKGSYSVLFFFRKMYKLVSRRIQELCYHFNQTQQS
NSEEPMIISMDLMEEVWHTVYYVLNEARGLMVSRHVDHIIMCSMYAICNKVNRMRISFKD
IIYNYRIICENIRMISPVEIGKILWQVPLDKEGDLGDIVKFYNLVYIPSVKGFILDKTSG
AALDRPEMPYVEIFTKTKIAPNFVLSPRKSNYSKNSLLSPMRHQDNYHTTLLLTPRTKAL
YEFGTNSTKKHFDQISTTPNRESTSSVINNSDISKRGVKRTLDFGGDDETTNNNNSDQGR
KFVKVMNQNPAYQ
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggtatcattacaattcgaatcaaccacttgctatagtgttctccaaaaggttcaaaag
aagttagttctttgccattgtctttttgagaaataccaagaatgtttccaagaagtaatt
actccaaacttgcaaatggataactttaaggctggttggataatattggttcttcttgct
agacatttaccttcttcattattggattttacagaaagtgtaaacttgttgattaatttt
atgatctcaatgtggaaagcatcacaaaactctagactatccgaaacaattgaagaatta
ttttctatttgcaatatctcaaaggataaattagattcaagatatgatgaatatattaga
acaaccctttcaaagttaacaattgaaaacctttcagattttgttaacaatattgattca
ctctctaaattgaatatgttgtttgataaggatgaagatttaaccttgggatcgttaggt
tttgatgaaagaattttcctctacagaaatgatatcaatcttattggtgacatttcaaaa
atcagttctgcaccagtttatcaactcaatccacctaaaccaacacaacataacgatcca
ttccgatcccctttaagatctccaggacactttactgcaacatcccaaactccattacaa
gcaagtcttcttgttatacagcttattgaagagtctacaaaaggtctttctagctcacca
gatgaaactttactaggctactttaaatcctgtaatatagatcaaacatccacaatagaa
aacagacttaagagcttggttgacaaagttaactttgaatcactattattatttaataag
gaaaagagaaaacaggaaataatgaaaatttactatggtaccttgaaacatatgctccaa
ggcgaagaaaaaagactaagtggcactgctaatttttcaactctcctcacaaacgaaaac
ttccacagatctttaacaatttgttctattgaatgcgtttcattcgcctacaattcaaaa
gataccattgacctccaagtattactcaatgagtttgtattagaaccatttgaattatcg
atagttctcgaaagttttgtccaaaatgccacatggctaaacagtgccctgaaacgtcaa
tttaaatcaatagaagaagtgttattggactcattagcctggaagaagaactctgtgctg
tattccaaacttagtacaagtgttgttccacaaccaccaaaacctggaaatgaaactcca
aacagaaattcaaatattgaatcctttggaatgtatagcccaatggcctcaagaaaacaa
caaccacaatcagctccaaagggttcatattctgttctattctttttcagaaaaatgtac
aaactagtctccagaagaattcaagaattatgttatcactttaaccaaacacaacaaagt
aactctgaggaaccaatgataatatcaatggatcttatggaagaagtgtggcacacagtg
tattatgtattgaatgaagctagaggtctgatggttagcagacatgttgatcatataatc
atgtgtagcatgtatgctatttgtaataaggtgaatagaatgcgtatttcatttaaagat
attatttataactatagaattatatgcgaaaatataagaatgatatcgccagtcgaaatt
ggtaaaattctttggcaagtaccattagacaaagaaggtgatttgggagatattgtcaaa
ttctataacttggtatatattccatctgttaaaggattcattctcgataagacttcaggt
gcagcacttgatagaccagaaatgccatatgttgaaattttcacaaaaaccaaaattgca
cctaactttgttctctctccacgaaagtctaactattccaagaacagtttactatcacca
atgagacatcaagataattatcatacaacccttcttttgacaccaagaacaaaagcactt
tatgaatttggaacaaatagtacaaagaaacactttgatcaaatatcgacaacacctaat
cgtgaatcgacatcgtcagtgatcaataatagtgatatttcaaagaggggtgtaaagaga
acccttgattttggtggtgatgatgaaacaaccaataacaataatagtgatcaaggacgt
aaatttgttaaggtaatgaaccaaaaccctgcctatcaataa

DBGET integrated database retrieval system