KEGG   Naegleria gruberi: NAEGRDRAFT_81056Help
Entry
NAEGRDRAFT_81056  CDS       T01241                                 

Definition
UDP-glucose pyrophosphorylase 2-like protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ngr  Naegleria gruberi
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NAEGRDRAFT_81056
   00052 Galactose metabolism
    NAEGRDRAFT_81056
   00500 Starch and sucrose metabolism
    NAEGRDRAFT_81056
   00520 Amino sugar and nucleotide sugar metabolism
    NAEGRDRAFT_81056
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NAEGRDRAFT_81056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 476 aa AA seqDB search
MEQAVQQLIEKSNGKEHFAQQMQDFLILFNRFVNEKDQSQIDWEKIRTPSEEDVKPYDSL
ADDTSDEAIQSLLSKLIVIKLNGGLGTTMGCTGPKSVIQVREEDTFLDLTIKQIQFLNSK
YNVDVPLVLMNSFNTSEDSKKIITAPKYANVKVRIECFEQNQFPRIIKESLLPLPSDIPS
DSNKEAWYPPGHGDFYSSFFQSPLYNQFKQEGKEYIFLSNIDNLGATVDLRVLKYLTENQ
VDFCMEVTKKTMADVKGGTLINYDGKAVKLLELAQVPKHHVKDFESIEKFKIFNTNNLWI
RLPSIETQLEELKRKVEIINNEKEVDGVKIIQLETAAGAAIQVFNKSLGIEVPRSRFLPV
KKCSDLMLVQSNLYNLSEGYCLEKSSTEEAPIINLDDSYYKKVGDYLSNFSNGVPDIKEL
TELDVRGHVVFGKNVVLKGKVTLIAKSKSIIADNTVLENTTLQLEPVSKINSNNNQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggaacaagctgtacaacaacttattgaaaagtctaacggaaaggaacactttgctcaa
caaatgcaagactttttaatcttgttcaatagatttgtcaatgaaaaggatcaatcacaa
atcgattgggaaaagattagaacaccttctgaggaagacgtcaaaccatacgattcactc
gctgacgacacttccgatgaagcaattcaatcacttttatctaaattaattgttattaaa
ttaaatggtggtttgggaactaccatgggttgcactggtccaaaatcagtcattcaagtc
cgagaggaagatactttcctcgatctcactatcaaacaaattcaatttttgaacagcaaa
tacaacgttgacgttcctttggttttaatgaattcattcaatacttcagaagattcaaag
aagattatcactgccccaaagtatgccaatgttaaagttagaattgaatgtttcgaacaa
aatcaatttccaagaattatcaaggaatcactacttccattaccatctgatattccaagt
gattccaataaggaagcttggtatccaccaggtcacggtgacttttatagctcattcttc
caatcaccattatataatcaattcaaacaagaaggaaaagaatatattttcctttctaat
attgacaatttaggtgctacagttgatcttagagttttgaagtatctcactgaaaatcaa
gtcgatttttgtatggaggtcactaagaaaactatggctgacgttaaaggaggtactttg
atcaattatgatggaaaggctgttaaattattagaacttgctcaagttccaaaacaccac
gttaaagattttgaatcaatcgaaaagttcaagattttcaataccaacaatttatggatt
cgtcttccatccattgaaactcaattggaagaattaaagagaaaggttgaaattattaat
aacgagaaggaagtggatggtgtcaagattattcaattggaaacagctgctggtgctgct
attcaagttttcaataagtcactcggtattgaagtccctagatctcgtttcttacctgtt
aagaaatgttctgatctcatgttagtccaatctaatttatataatctctctgagggttat
tgcttggaaaagtctagcactgaagaagctccaattattaatcttgatgatagttattat
aagaaggttggagactatctttcaaactttagcaatggtgtaccagatattaaggaactt
actgaactcgatgtccgtggtcatgttgtttttggaaagaacgttgttctcaaaggaaag
gttacactgatagcaaagagcaagtctattattgctgataatactgttttggaaaatacc
actttacaacttgaaccagtctctaaaatcaacagcaacaataatcaataa

DBGET integrated database retrieval system