KEGG   Naegleria gruberi: NAEGRDRAFT_81163Help
Entry
NAEGRDRAFT_81163  CDS       T01241                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ngr  Naegleria gruberi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAEGRDRAFT_81163
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAEGRDRAFT_81163
   00052 Galactose metabolism
    NAEGRDRAFT_81163
   00500 Starch and sucrose metabolism
    NAEGRDRAFT_81163
   00520 Amino sugar and nucleotide sugar metabolism
    NAEGRDRAFT_81163
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    NAEGRDRAFT_81163
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NAEGRDRAFT_81163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 441 aa AA seqDB search
MISSSSRGSLSSVSSNDTTHQPFVVDEDFLKDIEKHYSKSLKSKSFQYIVGVDVGATNTR
IAIQFIVNDEDDEVFMTKFPCNTATNLAEHLTFYGKALVKIVKQGSAAGTIALAGPVTGE
KVRITNYKENDQEFYYSQLTDTLFPAHKNTLLNDLEASCYGIINVGTNNRLHEFFCPYDS
ANNFATPQTVRLSDTSEYAVLAMGTGLGTGLIVGASGGKFNVIPLEAGHVHVATPGTNSC
DFHEDRERIEFLSQKIYSGIYPIEYEDICSGRGLEYCYEFEIRNIPNAQRKNAAQIAESY
STDVHSRDAMITHYRYLMQAAQNIAILIPTCRGVFLAGDNQVYNEDFFKEHINILQKELF
ITHQKKNWLTDLKPYRQMKEYNFNVKGCLQKAKELAHLDVTHVTTNTSPAKNSFKDALSV
VIPAAFFSVLSFFTAKNMYEK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgatttcatcatcaagtagaggaagtttgagtagtgttagtagcaatgatactacacat
caaccatttgttgtggatgaggactttttaaaggatattgaaaagcattatagtaaatca
ttgaagagtaaatctttccaatatattgttggtgttgatgtaggtgcaactaatacaaga
attgccatccaatttattgttaatgatgaggatgatgaagtattcatgactaaattccca
tgtaatactgctaccaacttggcagaacatcttacattttatggtaaagctttggttaaa
attgttaaacaaggaagtgctgctggtactattgctcttgcaggtccagttactggagaa
aaggttagaattacaaactacaaggaaaatgatcaggaattttactattctcaactcact
gatactctcttccctgctcataagaataccttgttgaatgatcttgaagccagttgttat
ggtattattaatgttggcaccaataatcgtctccatgaattcttctgtccatatgatagt
gctaataattttgcaacaccacaaacagtaagactttccgatactagtgaatatgctgtt
ttggctatgggaactggtttgggaactggattgattgttggagcttctggaggtaaattt
aatgttattccattggaagctggtcacgttcatgttgctactcctggtactaattcatgt
gatttccacgaagatcgtgaaagaattgaattccttagtcaaaagatttatagtggtatt
tacccaattgaatatgaggatatttgtagtggaagaggtttggaatattgttatgaattt
gaaattagaaatattcccaatgctcaaagaaagaatgctgctcaaattgctgaatcttac
tcaactgatgtacattcaagagatgccatgattacacactatcgttacttgatgcaagct
gctcaaaatattgctattttgattccaacttgtcgtggtgtcttccttgctggtgacaat
caagtatacaatgaagatttctttaaggaacacattaatatcctccaaaaggaactcttc
ataactcaccaaaagaaaaactggttgacagacttgaaaccatacagacaaatgaaggaa
tataactttaatgttaagggttgtcttcaaaaggctaaggaactagcccatcttgatgtt
actcatgtcactaccaatacctctccagctaagaacagctttaaggatgctctttctgtt
gttataccagctgccttcttctctgtactttccttcttcactgctaagaatatgtatgaa
aagtaa

DBGET integrated database retrieval system