KEGG   Naegleria gruberi: NAEGRDRAFT_81289Help
Entry
NAEGRDRAFT_81289  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
ngr  Naegleria gruberi
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NAEGRDRAFT_81289
   03420 Nucleotide excision repair
    NAEGRDRAFT_81289
   03430 Mismatch repair
    NAEGRDRAFT_81289
   03440 Homologous recombination
    NAEGRDRAFT_81289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 253 aa AA seqDB search
MDDHDFRGSDVHGGEDVDQSMVHNTSHVNSSESASEKGGITPVNIRQLIHAEMPETNHFV
IDCKTKKKRIEQVTLVAQIVKFTNEPEKRKLNLFLDDGTGRMSVILYAIDTEKKFEACGG
VIENGLFLRIYGILNIDNRTGTRYIVGTGLSLIMDINEFTTHLLDVIVASLHSQYGSLVG
KKVPKVQQQKTLEVSIYELVAKKPGISFHEVVSELNSDFDATIAAFQILFEGGNLGYAPN
STEQYVVANKLFY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcatgattttagaggaagtgatgtgcatggtggtgaagatgtagatcaatcc
atggtacataacacatcacatgtaaatagtagtgaaagtgcttccgagaaaggaggtatt
acacctgtaaatattagacaattaatccatgccgaaatgccagaaaccaatcatttcgtc
attgactgcaagacaaagaagaaaagaattgaacaagttactcttgttgcacaaattgta
aaatttactaatgaacccgagaaacgaaaattaaatttattccttgatgatggtacagga
aggatgagcgtaattttgtacgcaattgatactgagaaaaagtttgaagcttgtggtggt
gttattgaaaatggactctttttgagaatttatggtattttgaatattgataatagaact
ggaacaagatatattgttggtacaggtttatcactaattatggatatcaatgaatttacc
actcacttattggacgtaattgttgcatctctgcattctcaatatggttcacttgtaggg
aagaaagtgccaaaagttcaacaacaaaaaactctggaagtgtctatctatgaacttgtt
gctaagaaaccaggcatttcatttcatgaagttgtttcagaattgaattctgattttgat
gcaactattgctgctttccaaattttattcgaaggaggtaatctaggatatgcaccaaat
agcactgaacaatatgttgttgcaaataaactcttctactaa

DBGET integrated database retrieval system