KEGG   Naegleria gruberi: NAEGRDRAFT_81289Help
Entry
NAEGRDRAFT_81289  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K10739  replication factor A2
Organism
ngr  Naegleria gruberi
Pathway
ngr03030  DNA replication
ngr03420  Nucleotide excision repair
ngr03430  Mismatch repair
ngr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NAEGRDRAFT_81289
   03420 Nucleotide excision repair
    NAEGRDRAFT_81289
   03430 Mismatch repair
    NAEGRDRAFT_81289
   03440 Homologous recombination
    NAEGRDRAFT_81289
DNA replication proteins [BR:ngr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    NAEGRDRAFT_81289
DNA repair and recombination proteins [BR:ngr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     NAEGRDRAFT_81289
   MMR (mismatch exicision repair)
     NAEGRDRAFT_81289
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     NAEGRDRAFT_81289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 8854142
NCBI-ProteinID: XP_002672290
JGI: Naegr1_81289
AA seq 253 aa AA seqDB search
MDDHDFRGSDVHGGEDVDQSMVHNTSHVNSSESASEKGGITPVNIRQLIHAEMPETNHFV
IDCKTKKKRIEQVTLVAQIVKFTNEPEKRKLNLFLDDGTGRMSVILYAIDTEKKFEACGG
VIENGLFLRIYGILNIDNRTGTRYIVGTGLSLIMDINEFTTHLLDVIVASLHSQYGSLVG
KKVPKVQQQKTLEVSIYELVAKKPGISFHEVVSELNSDFDATIAAFQILFEGGNLGYAPN
STEQYVVANKLFY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcatgattttagaggaagtgatgtgcatggtggtgaagatgtagatcaatcc
atggtacataacacatcacatgtaaatagtagtgaaagtgcttccgagaaaggaggtatt
acacctgtaaatattagacaattaatccatgccgaaatgccagaaaccaatcatttcgtc
attgactgcaagacaaagaagaaaagaattgaacaagttactcttgttgcacaaattgta
aaatttactaatgaacccgagaaacgaaaattaaatttattccttgatgatggtacagga
aggatgagcgtaattttgtacgcaattgatactgagaaaaagtttgaagcttgtggtggt
gttattgaaaatggactctttttgagaatttatggtattttgaatattgataatagaact
ggaacaagatatattgttggtacaggtttatcactaattatggatatcaatgaatttacc
actcacttattggacgtaattgttgcatctctgcattctcaatatggttcacttgtaggg
aagaaagtgccaaaagttcaacaacaaaaaactctggaagtgtctatctatgaacttgtt
gctaagaaaccaggcatttcatttcatgaagttgtttcagaattgaattctgattttgat
gcaactattgctgctttccaaattttattcgaaggaggtaatctaggatatgcaccaaat
agcactgaacaatatgttgttgcaaataaactcttctactaa

DBGET integrated database retrieval system