KEGG   Naegleria gruberi: NAEGRDRAFT_81289Help
Entry
NAEGRDRAFT_81289  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
ngr  Naegleria gruberi
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NAEGRDRAFT_81289
   03420 Nucleotide excision repair
    NAEGRDRAFT_81289
   03430 Mismatch repair
    NAEGRDRAFT_81289
   03440 Homologous recombination
    NAEGRDRAFT_81289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 253 aa AA seqDB search
MDDHDFRGSDVHGGEDVDQSMVHNTSHVNSSESASEKGGITPVNIRQLIHAEMPETNHFV
IDCKTKKKRIEQVTLVAQIVKFTNEPEKRKLNLFLDDGTGRMSVILYAIDTEKKFEACGG
VIENGLFLRIYGILNIDNRTGTRYIVGTGLSLIMDINEFTTHLLDVIVASLHSQYGSLVG
KKVPKVQQQKTLEVSIYELVAKKPGISFHEVVSELNSDFDATIAAFQILFEGGNLGYAPN
STEQYVVANKLFY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcatgattttagaggaagtgatgtgcatggtggtgaagatgtagatcaatcc
atggtacataacacatcacatgtaaatagtagtgaaagtgcttccgagaaaggaggtatt
acacctgtaaatattagacaattaatccatgccgaaatgccagaaaccaatcatttcgtc
attgactgcaagacaaagaagaaaagaattgaacaagttactcttgttgcacaaattgta
aaatttactaatgaacccgagaaacgaaaattaaatttattccttgatgatggtacagga
aggatgagcgtaattttgtacgcaattgatactgagaaaaagtttgaagcttgtggtggt
gttattgaaaatggactctttttgagaatttatggtattttgaatattgataatagaact
ggaacaagatatattgttggtacaggtttatcactaattatggatatcaatgaatttacc
actcacttattggacgtaattgttgcatctctgcattctcaatatggttcacttgtaggg
aagaaagtgccaaaagttcaacaacaaaaaactctggaagtgtctatctatgaacttgtt
gctaagaaaccaggcatttcatttcatgaagttgtttcagaattgaattctgattttgat
gcaactattgctgctttccaaattttattcgaaggaggtaatctaggatatgcaccaaat
agcactgaacaatatgttgttgcaaataaactcttctactaa

DBGET integrated database retrieval system