KEGG   Naegleria gruberi: NAEGRDRAFT_81801Help
Entry
NAEGRDRAFT_81801  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ngr  Naegleria gruberi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 1013 aa AA seqDB search
MARTSSPSSTFAILPPTSVFGTNSQSTIYNNNMIINNPNSSSFQQNYQQFPSQFYHHIPP
SHQQQHQYSNNGGSNLLLSNSNVLTTAPNNNNYITPHSMNNSNNISNNLNSIPLVNTSNI
QYDKSIPSTYQQHSIVNNSIPNHDGLIIPSQLQNVPPYSNSQVSVSLYSDLASSTYQQPN
TPNIYQHRNSNNNNRDIVTSILTLSDVEQSIPSSKYYQQPQNNRSSTHQSLFYSNFTNGG
SINNLNSQNSIPSGSSNADVIMRNSNSSNGGLIMNQTPNIQNNSYSSNTNKILLKPKVIN
QRSDAHYQKVLATPTSTLIDNTLSQKRKESNTIKLSVNVLKTYKTINDIYYTRKQEERRL
RHLKNGKSSQSTPSSKQRKTYSSSQYVDPQKNGYPSQTLPNIGSTQLTTSLYQSNPYPEV
ANNPNYQQDIPSQQQYSQPLMYSSSNFSNNPVQLYNYQPTNTYNPPQYNNNSLMHSQILQ
PPPPYTQQEQYPKNQVPNIASNNSNNQNFYQQPINVPQPSVSQSSSDSQGNYIVKLSELI
NERYLVEEIMGKGSFGIVVKAYDCVNDESVAVKIIKNKPQFHSQAQIEIGLLKDLNSKDT
DGKNNIVRMKHYFAWKNHLCIVFELLSMNLYDLLKATNFNGISLLRIYRFGKELLRTLCF
LSRPDVQVIHCDLKPENILLKNSKKTSIKVIDFGSSCYVNNKMYKYIQSRFYRSPEVILG
LPYGTEIDMWSYGCILVELHTGNPLFDGKNEADQIFKIIQLLGMPPRKMIEQSPKKDKFF
KFNSSIGQYEPLDSTIVPSSISLYDIIINISPKRHVSPYSCPFETFENYLKLYNVVTKIL
HYDPQQRLKPAETLQEEFFKINEVAHNVMQVQGSANQSNFASSSTVPTLNGGPQSFSNPF
MYVSQVNLPVQNNGGFSIQPINGGGYNPSGYAPSLPTQTPSSSSAHQFLPTPQSMYRTSG
NSSMIPLTSSMMSTNSSSIMNNGYVITNGNNNSGVLINHNNNSNNNMATDYQL
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaacatcatctccttcatcaacatttgcaattctaccaccaacatctgtattt
ggaactaatagtcagtctacaatatacaacaataatatgatcatcaataatcctaattca
tcatccttccaacaaaattatcaacaatttccttctcaattctatcatcatataccacca
tcacatcaacaacaacatcaatacagtaacaatggtggatcaaatttattgctttctaat
agtaacgtacttactacagcaccaaataataataattatataacacctcactctatgaat
aacagtaacaatatatccaataatttaaattctatccctttagtcaacacttccaatatt
caatatgataaatcaataccatcaacatatcaacaacattctatagtaaataattcgata
ccaaatcatgatggtcttatcattccgagtcagttacaaaatgttcctccctattccaac
tctcaagttagtgtttctctttattccgatttagcttcttcgacttatcaacaaccaaat
actccaaatatctatcaacatagaaatagcaataataataatcgtgatattgtcacttct
atactgactctttcagatgttgaacaatctattccatcttcaaaatactatcaacaacct
caaaataatagatcttcgacgcatcaatcattattctattccaattttacaaatggtgga
agtataaataatttgaattcacaaaactcaataccttcaggtagtagtaacgcagatgtg
attatgagaaatagtaactcctcaaatggaggtttaattatgaatcagacaccaaacatt
caaaataatagctattcgagtaacacaaacaaaattctattgaaacctaaagtaattaat
caaagatccgatgcacattaccaaaaagttttggcaacaccaacatcaacactcatcgac
aacactttatctcaaaagagaaaggaatcgaatactatcaaattatcagttaacgtcttg
aaaacatacaaaactattaatgacatttactatactagaaaacaagaggaaagaagattg
agacatttaaaaaatggaaaatcatctcaatcaacaccatcatcaaaacaaagaaaaacc
tattcatcaagtcaatatgtggatccacaaaagaatggatatccatctcaaacgttacca
aatattggaagcactcaattgacaacaagcctttatcaaagtaatccataccctgaagtt
gctaataacccaaattaccaacaagacattccttctcaacaacaatatagtcaaccatta
atgtatagctcatcgaatttcagtaataacccagtacaattgtataactaccaaccaaca
aacacatataaccctccacagtataacaacaattcactaatgcattcccaaatattacaa
cctccacctccatatactcaacaagaacaatatccaaagaatcaagtacctaacattgct
tcaaataattctaataatcagaatttctaccaacaacctattaatgtacctcaaccatct
gtaagtcaaagttcttcagactctcaaggaaattatattgttaaattgagtgaactgatc
aatgaaaggtatttagtcgaagaaattatgggtaaaggatcttttggaattgttgtaaaa
gcatatgactgcgtcaatgatgaaagtgtggcagttaaaattatcaaaaataagccacaa
tttcatagccaagcccaaatagagattgggttgttgaaagacttgaactcaaaagatact
gatggtaagaacaatattgtaaggatgaaacactattttgcatggaagaaccatctttgc
attgtttttgagcttctttcgatgaatctttacgatttgttaaaagcaacaaactttaat
ggaatatctttattgagaatctatagatttggaaaagaattacttcgtacattgtgcttc
ctttcaagaccagatgtacaagttattcattgtgatttaaaacctgaaaatattttgttg
aaaaattcaaagaaaacgagtatcaaagttatagattttggaagttcttgttacgtaaat
aacaagatgtataaatatattcaaagtagattttatagatcgcctgaggtaatattgggg
ttaccttatggaacagaaattgatatgtggagttatgggtgtattcttgttgaattgcac
acaggtaatccattatttgatggaaaaaatgaagctgatcagatattcaaaattattcag
ttattaggaatgccaccaagaaaaatgattgaacaatctccaaagaaggacaaattcttc
aagtttaattcctctataggacaatacgaacctcttgattcaacaattgtaccatcctca
atttcactttatgatattattattaatatttcaccaaagagacatgtttcaccatactct
tgcccatttgaaacatttgagaattaccttaaactttacaatgttgtcaccaagattctc
cactatgatcctcaacaaagattaaaaccagcagaaactttacaagaagaatttttcaaa
attaatgaggtggcacataatgtaatgcaagttcaaggctctgcaaatcaatccaatttt
gcatcatcctcaacagttccaacattgaatggtggtccacaatcgttttcaaaccccttt
atgtatgtttcacaagttaatctcccagtccaaaataacggaggattttccattcagccg
attaatggtggtggctataatccgtctggttatgctccatctctcccaactcaaacacca
tcctcttcgtcagctcatcaatttttacctactccacaatcaatgtatagaacttctggt
aactcctcaatgattcccttaacatcaagcatgatgagtacaaacagttcctcaattatg
aataatggatatgttattacgaatggcaataataacagcggtgttcttatcaatcataat
aacaacagtaataataatatggccacagactatcagttgtaa

DBGET integrated database retrieval system