KEGG   Naegleria gruberi: NAEGRDRAFT_82002Help
Entry
NAEGRDRAFT_82002  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K03253  translation initiation factor 3 subunit B
Organism
ngr  Naegleria gruberi
Pathway
ngr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NAEGRDRAFT_82002
Messenger RNA biogenesis [BR:ngr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     NAEGRDRAFT_82002
Translation factors [BR:ngr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    NAEGRDRAFT_82002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF2A RRM_1 TF_AP-2 YqeY
Motif
Other DBs
NCBI-GeneID: 8856810
NCBI-ProteinID: XP_002669875
JGI: Naegr1_82002
AA seq 660 aa AA seqDB search
MSKQYIVTPRDIQNFDENEEFVFDEPEVTFNDDISNVVVIDGLPIIDQAKEEALKSKVVQ
IIEKKAEAKIVNFYIPYQAGKSKGMAIVELSTAEQAKKVLDGIEGFKFASFTLHSISAAE
VDKYQKFDETTYQQQHKQQSKQYKERDNLVSWLKDPNARSQYAIRYDETVDICWNDPLHV
KEIIYSKERWSDDKIDFSPLGSYIVTYHEKGVALWGGPEFKDQDTLSHRNVISVQFSPNE
SFVVTVSESPARAVLWDLRAQRKAMSLPLKDRSALKGHVFKWSADEKYFAKMGVDCIHIF
DSSTMELLHQKTYSVPGVRDFAFNPVGKSFMIYSAINDTNGEGLVTLVDINSRSIKELKS
KPYYNSTDIKLNWQLSGDYIAIATSRESTIQMEKVITTAFDVMKVNQKNFPIEGIADFND
CVDEFEFEPIGDTLAIIHGPGNVKKSFSLYSFKNAVHKLIKKCEGKTINRMLWSPRGHDL
VLMNTKLVSVTLEFWNAEEGELVGTGEHFSMTDACWDPSGRYFSTFVSAERRSNDNGFII
WTFLGKVMHKANVERLLEFKWRPRIKSLLTANMEKEVKKRLPNKKVEIEQKLLQEAKALR
EAKLKKRKSAWDEFEQVLARLKSQYEKMKPELIALKGYDPDEFNQEEVDEVIETIEEIVE
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcaatacattgtcacgccgcgcgacattcaaaactttgatgaaaacgaagaa
tttgtttttgatgaacctgaagtaacttttaatgacgatatttccaatgttgttgttatt
gatggtttaccaatcattgaccaagccaaggaagaagctttaaagagcaaggttgttcaa
attatagaaaagaaagccgaagcaaagattgttaatttttatattccatatcaagcagga
aagtctaaaggtatggctattgtagaactttcaacagcagaacaagctaaaaaggtcctt
gatggaattgaaggatttaaatttgccagttttactcttcactcaatttctgcagctgaa
gtggacaagtatcaaaaattcgacgaaacaacataccaacaacaacacaaacaacaatca
aaacaatacaaggaaagagataatttggtcagctggttgaaggatcctaacgcaagaagt
caatatgctattagatatgatgaaactgttgatatttgttggaatgatccacttcacgtt
aaagaaattatttactctaaagaaagatggtccgatgataagattgacttttcaccactt
ggttcatatattgttacttatcacgaaaaaggtgttgccttgtggggtggtccagaattc
aaagaccaagatactctttcacataggaacgttattagtgttcaattctcaccaaacgaa
tcatttgttgtaactgttagtgaaagtccagctagagctgtcttgtgggatttgagagcc
caaagaaaggccatgtctcttccattgaaggatagaagtgctcttaaaggacatgttttc
aagtggagtgctgatgaaaaatactttgccaagatgggtgtagattgtatccacattttc
gattcttctactatggaattgctccaccaaaagacatactctgttccaggtgtcagagat
tttgctttcaatcctgttggtaaatctttcatgatttattccgctattaatgataccaat
ggagaaggtttggttactttggttgatattaacagtagatcaatcaaggaattgaagtct
aaaccatactataactctactgatattaagctcaactggcaacttagtggtgactacatt
gctattgctactagtcgtgaatcaacaattcaaatggaaaaggtcattacaactgctttc
gatgttatgaaagttaaccaaaagaacttcccaattgaaggtattgctgattttaatgat
tgtgtcgatgaattcgaatttgaaccaatcggagatactctcgccattattcacggacct
ggtaatgtcaagaagtctttcagtttgtattcattcaagaatgctgttcacaagctcatt
aagaaatgtgaaggaaagacaattaatagaatgttgtggagtcctcgtggtcatgatttg
gttctcatgaatacaaagcttgtcagtgttactctcgaattctggaatgctgaagaaggt
gaacttgttggtacaggagaacacttctctatgactgatgcttgttgggatccatctggt
agatatttctctacttttgttagtgctgaacgtagatcaaatgacaatggtttcattatc
tggacattcttgggtaaggttatgcataaggctaacgttgaaagactcctcgaattcaaa
tggagaccaagaatcaaatcactcctcactgctaacatggaaaaggaagtcaagaagaga
ttaccaaacaagaaggttgaaattgaacaaaaacttttacaagaagctaaggctttgcgt
gaagctaagctcaagaagagaaagagtgcttgggatgaatttgaacaagttttggccaga
ctgaagtctcaatacgaaaagatgaaaccagaattgattgctcttaagggttatgatcct
gatgaatttaatcaagaagaagttgatgaagttattgaaacaattgaagaaattgtcgag
taa

DBGET integrated database retrieval system