KEGG   Naegleria gruberi: NAEGRDRAFT_82002Help
Entry
NAEGRDRAFT_82002  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ngr  Naegleria gruberi
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ngr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 660 aa AA seqDB search
MSKQYIVTPRDIQNFDENEEFVFDEPEVTFNDDISNVVVIDGLPIIDQAKEEALKSKVVQ
IIEKKAEAKIVNFYIPYQAGKSKGMAIVELSTAEQAKKVLDGIEGFKFASFTLHSISAAE
VDKYQKFDETTYQQQHKQQSKQYKERDNLVSWLKDPNARSQYAIRYDETVDICWNDPLHV
KEIIYSKERWSDDKIDFSPLGSYIVTYHEKGVALWGGPEFKDQDTLSHRNVISVQFSPNE
SFVVTVSESPARAVLWDLRAQRKAMSLPLKDRSALKGHVFKWSADEKYFAKMGVDCIHIF
DSSTMELLHQKTYSVPGVRDFAFNPVGKSFMIYSAINDTNGEGLVTLVDINSRSIKELKS
KPYYNSTDIKLNWQLSGDYIAIATSRESTIQMEKVITTAFDVMKVNQKNFPIEGIADFND
CVDEFEFEPIGDTLAIIHGPGNVKKSFSLYSFKNAVHKLIKKCEGKTINRMLWSPRGHDL
VLMNTKLVSVTLEFWNAEEGELVGTGEHFSMTDACWDPSGRYFSTFVSAERRSNDNGFII
WTFLGKVMHKANVERLLEFKWRPRIKSLLTANMEKEVKKRLPNKKVEIEQKLLQEAKALR
EAKLKKRKSAWDEFEQVLARLKSQYEKMKPELIALKGYDPDEFNQEEVDEVIETIEEIVE
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcaatacattgtcacgccgcgcgacattcaaaactttgatgaaaacgaagaa
tttgtttttgatgaacctgaagtaacttttaatgacgatatttccaatgttgttgttatt
gatggtttaccaatcattgaccaagccaaggaagaagctttaaagagcaaggttgttcaa
attatagaaaagaaagccgaagcaaagattgttaatttttatattccatatcaagcagga
aagtctaaaggtatggctattgtagaactttcaacagcagaacaagctaaaaaggtcctt
gatggaattgaaggatttaaatttgccagttttactcttcactcaatttctgcagctgaa
gtggacaagtatcaaaaattcgacgaaacaacataccaacaacaacacaaacaacaatca
aaacaatacaaggaaagagataatttggtcagctggttgaaggatcctaacgcaagaagt
caatatgctattagatatgatgaaactgttgatatttgttggaatgatccacttcacgtt
aaagaaattatttactctaaagaaagatggtccgatgataagattgacttttcaccactt
ggttcatatattgttacttatcacgaaaaaggtgttgccttgtggggtggtccagaattc
aaagaccaagatactctttcacataggaacgttattagtgttcaattctcaccaaacgaa
tcatttgttgtaactgttagtgaaagtccagctagagctgtcttgtgggatttgagagcc
caaagaaaggccatgtctcttccattgaaggatagaagtgctcttaaaggacatgttttc
aagtggagtgctgatgaaaaatactttgccaagatgggtgtagattgtatccacattttc
gattcttctactatggaattgctccaccaaaagacatactctgttccaggtgtcagagat
tttgctttcaatcctgttggtaaatctttcatgatttattccgctattaatgataccaat
ggagaaggtttggttactttggttgatattaacagtagatcaatcaaggaattgaagtct
aaaccatactataactctactgatattaagctcaactggcaacttagtggtgactacatt
gctattgctactagtcgtgaatcaacaattcaaatggaaaaggtcattacaactgctttc
gatgttatgaaagttaaccaaaagaacttcccaattgaaggtattgctgattttaatgat
tgtgtcgatgaattcgaatttgaaccaatcggagatactctcgccattattcacggacct
ggtaatgtcaagaagtctttcagtttgtattcattcaagaatgctgttcacaagctcatt
aagaaatgtgaaggaaagacaattaatagaatgttgtggagtcctcgtggtcatgatttg
gttctcatgaatacaaagcttgtcagtgttactctcgaattctggaatgctgaagaaggt
gaacttgttggtacaggagaacacttctctatgactgatgcttgttgggatccatctggt
agatatttctctacttttgttagtgctgaacgtagatcaaatgacaatggtttcattatc
tggacattcttgggtaaggttatgcataaggctaacgttgaaagactcctcgaattcaaa
tggagaccaagaatcaaatcactcctcactgctaacatggaaaaggaagtcaagaagaga
ttaccaaacaagaaggttgaaattgaacaaaaacttttacaagaagctaaggctttgcgt
gaagctaagctcaagaagagaaagagtgcttgggatgaatttgaacaagttttggccaga
ctgaagtctcaatacgaaaagatgaaaccagaattgattgctcttaagggttatgatcct
gatgaatttaatcaagaagaagttgatgaagttattgaaacaattgaagaaattgtcgag
taa

DBGET integrated database retrieval system