KEGG   Naegleria gruberi: NAEGRDRAFT_82846Help
Entry
NAEGRDRAFT_82846  CDS       T01241                                 

Definition
beta-amylase
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
ngr  Naegleria gruberi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ngr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 432 aa AA seqDB search
MMPLNTVNSDGSLNNPEKIYDYLQRVKQVGTDGIMIDVWWGIIEPSPQQYNFNAYMQLFT
MCRQVGLKVEPVLSFHQCGTNVGDACYIPLPLWIHQVVGDKNPEIFYTDQNGHRDREYLS
LGVDSEALFPSNDSRRNRTPLEMYEQVMIQFNATFSSFIKGGVIDTIEIGLGPAGEMRYP
SYQLQDNMWSFPGIGAFQCYDRYMLQDLAKAAREVGHPEWGKTGPANAGNYNSRPFETGF
FSENTFDNYDSSYGKFFIGWYTAKLIQHGDAILGRARSVFGQSSKLATKIAGIHWWYYTW
SHAAELTAGYYNTIHYNGYIDIAKMFKKHNVEFQFTCLEMKDREQPSDCACGPEELVALT
RESAFNLGLKYGGENALEILGNYAANQQIAKQSISDGKSISSFTFLRMSDELMASSQYMG
SYANLVYVMHNL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatgccactcaatacagtgaattcagacggatcgttgaataatccagagaaaatttac
gattacttgcaacgagtaaaacaagtaggaacagacggaataatgattgacgtttggtgg
ggaattattgaaccatctccccaacaatacaatttcaatgcctacatgcaactgtttacc
atgtgtcgacaggtgggtttaaaggtggagccagttctttcctttcatcaatgtggaacc
aatgtaggtgatgcatgctacattccattgccattgtggattcatcaagtggtgggtgat
aaaaatccagagattttctacactgaccagaatggacacagagacagggagtatctttcg
ctaggagttgattcggaagcactatttccaagcaatgattcgagaagaaatagaactcct
ctcgaaatgtacgaacaagttatgattcaattcaatgctacattttcttcgtttattaag
ggtggagtaattgatacgattgagattggtctaggacctgctggagaaatgagatatccc
tcctatcagttgcaagataatatgtggagttttcctggaattggcgcatttcaatgttat
gatcgatatatgctgcaagatttggccaaggcagcgagagaagtaggtcatccagaatgg
ggaaagacaggtccggccaatgctggcaattacaactctcggccattcgaaactggtttc
ttctctgagaatacttttgataattatgattccagttatggtaaattctttattggatgg
tatacagccaaacttattcaacatggtgatgccattttgggaagagctagatcagtattt
ggtcaatcaagcaaattggcaaccaaaatagcaggcattcattggtggtattatacatgg
agtcacgcagctgaactcacggccggttactacaacacgatccattacaatggttatatt
gacattgccaaaatgttcaaaaaacacaatgtagaattccaatttacatgtttggaaatg
aaagatcgagaacaaccctccgattgtgcatgtggtccagaagagttggttgccctcaca
cgagaatcagctttcaatttgggattgaaatatggaggtgagaatgctttggaaattttg
ggaaattacgcagcaaatcaacaaattgcaaaacagtcgattagtgacggcaagtcaatt
tctagttttacatttttgagaatgtcagatgagttgatggctagttctcagtatatggga
agttatgctaatcttgtttacgtgatgcataatttgtaa

DBGET integrated database retrieval system