KEGG   Naegleria gruberi: NAEGRDRAFT_82846Help
Entry
NAEGRDRAFT_82846  CDS       T01241                                 

Definition
beta-amylase
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
ngr  Naegleria gruberi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NAEGRDRAFT_82846
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     NAEGRDRAFT_82846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 432 aa AA seqDB search
MMPLNTVNSDGSLNNPEKIYDYLQRVKQVGTDGIMIDVWWGIIEPSPQQYNFNAYMQLFT
MCRQVGLKVEPVLSFHQCGTNVGDACYIPLPLWIHQVVGDKNPEIFYTDQNGHRDREYLS
LGVDSEALFPSNDSRRNRTPLEMYEQVMIQFNATFSSFIKGGVIDTIEIGLGPAGEMRYP
SYQLQDNMWSFPGIGAFQCYDRYMLQDLAKAAREVGHPEWGKTGPANAGNYNSRPFETGF
FSENTFDNYDSSYGKFFIGWYTAKLIQHGDAILGRARSVFGQSSKLATKIAGIHWWYYTW
SHAAELTAGYYNTIHYNGYIDIAKMFKKHNVEFQFTCLEMKDREQPSDCACGPEELVALT
RESAFNLGLKYGGENALEILGNYAANQQIAKQSISDGKSISSFTFLRMSDELMASSQYMG
SYANLVYVMHNL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatgccactcaatacagtgaattcagacggatcgttgaataatccagagaaaatttac
gattacttgcaacgagtaaaacaagtaggaacagacggaataatgattgacgtttggtgg
ggaattattgaaccatctccccaacaatacaatttcaatgcctacatgcaactgtttacc
atgtgtcgacaggtgggtttaaaggtggagccagttctttcctttcatcaatgtggaacc
aatgtaggtgatgcatgctacattccattgccattgtggattcatcaagtggtgggtgat
aaaaatccagagattttctacactgaccagaatggacacagagacagggagtatctttcg
ctaggagttgattcggaagcactatttccaagcaatgattcgagaagaaatagaactcct
ctcgaaatgtacgaacaagttatgattcaattcaatgctacattttcttcgtttattaag
ggtggagtaattgatacgattgagattggtctaggacctgctggagaaatgagatatccc
tcctatcagttgcaagataatatgtggagttttcctggaattggcgcatttcaatgttat
gatcgatatatgctgcaagatttggccaaggcagcgagagaagtaggtcatccagaatgg
ggaaagacaggtccggccaatgctggcaattacaactctcggccattcgaaactggtttc
ttctctgagaatacttttgataattatgattccagttatggtaaattctttattggatgg
tatacagccaaacttattcaacatggtgatgccattttgggaagagctagatcagtattt
ggtcaatcaagcaaattggcaaccaaaatagcaggcattcattggtggtattatacatgg
agtcacgcagctgaactcacggccggttactacaacacgatccattacaatggttatatt
gacattgccaaaatgttcaaaaaacacaatgtagaattccaatttacatgtttggaaatg
aaagatcgagaacaaccctccgattgtgcatgtggtccagaagagttggttgccctcaca
cgagaatcagctttcaatttgggattgaaatatggaggtgagaatgctttggaaattttg
ggaaattacgcagcaaatcaacaaattgcaaaacagtcgattagtgacggcaagtcaatt
tctagttttacatttttgagaatgtcagatgagttgatggctagttctcagtatatggga
agttatgctaatcttgtttacgtgatgcataatttgtaa

DBGET integrated database retrieval system