KEGG   Naegleria gruberi: NAEGRDRAFT_82846Help
Entry
NAEGRDRAFT_82846  CDS       T01241                                 

Definition
(RefSeq) beta-amylase
Organism
ngr  Naegleria gruberi
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_14 Glyco_hydro_35
Motif
Other DBs
NCBI-GeneID: 8862516
NCBI-ProteinID: XP_002669193
JGI: Naegr1_82846
AA seq 432 aa AA seqDB search
MMPLNTVNSDGSLNNPEKIYDYLQRVKQVGTDGIMIDVWWGIIEPSPQQYNFNAYMQLFT
MCRQVGLKVEPVLSFHQCGTNVGDACYIPLPLWIHQVVGDKNPEIFYTDQNGHRDREYLS
LGVDSEALFPSNDSRRNRTPLEMYEQVMIQFNATFSSFIKGGVIDTIEIGLGPAGEMRYP
SYQLQDNMWSFPGIGAFQCYDRYMLQDLAKAAREVGHPEWGKTGPANAGNYNSRPFETGF
FSENTFDNYDSSYGKFFIGWYTAKLIQHGDAILGRARSVFGQSSKLATKIAGIHWWYYTW
SHAAELTAGYYNTIHYNGYIDIAKMFKKHNVEFQFTCLEMKDREQPSDCACGPEELVALT
RESAFNLGLKYGGENALEILGNYAANQQIAKQSISDGKSISSFTFLRMSDELMASSQYMG
SYANLVYVMHNL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatgccactcaatacagtgaattcagacggatcgttgaataatccagagaaaatttac
gattacttgcaacgagtaaaacaagtaggaacagacggaataatgattgacgtttggtgg
ggaattattgaaccatctccccaacaatacaatttcaatgcctacatgcaactgtttacc
atgtgtcgacaggtgggtttaaaggtggagccagttctttcctttcatcaatgtggaacc
aatgtaggtgatgcatgctacattccattgccattgtggattcatcaagtggtgggtgat
aaaaatccagagattttctacactgaccagaatggacacagagacagggagtatctttcg
ctaggagttgattcggaagcactatttccaagcaatgattcgagaagaaatagaactcct
ctcgaaatgtacgaacaagttatgattcaattcaatgctacattttcttcgtttattaag
ggtggagtaattgatacgattgagattggtctaggacctgctggagaaatgagatatccc
tcctatcagttgcaagataatatgtggagttttcctggaattggcgcatttcaatgttat
gatcgatatatgctgcaagatttggccaaggcagcgagagaagtaggtcatccagaatgg
ggaaagacaggtccggccaatgctggcaattacaactctcggccattcgaaactggtttc
ttctctgagaatacttttgataattatgattccagttatggtaaattctttattggatgg
tatacagccaaacttattcaacatggtgatgccattttgggaagagctagatcagtattt
ggtcaatcaagcaaattggcaaccaaaatagcaggcattcattggtggtattatacatgg
agtcacgcagctgaactcacggccggttactacaacacgatccattacaatggttatatt
gacattgccaaaatgttcaaaaaacacaatgtagaattccaatttacatgtttggaaatg
aaagatcgagaacaaccctccgattgtgcatgtggtccagaagagttggttgccctcaca
cgagaatcagctttcaatttgggattgaaatatggaggtgagaatgctttggaaattttg
ggaaattacgcagcaaatcaacaaattgcaaaacagtcgattagtgacggcaagtcaatt
tctagttttacatttttgagaatgtcagatgagttgatggctagttctcagtatatggga
agttatgctaatcttgtttacgtgatgcataatttgtaa

DBGET integrated database retrieval system