KEGG   Naegleria gruberi: NAEGRDRAFT_82870Help
Entry
NAEGRDRAFT_82870  CDS       T01241                                 

Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ngr  Naegleria gruberi
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NAEGRDRAFT_82870
Enzymes [BR:ngr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     NAEGRDRAFT_82870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 269 aa AA seqDB search
MGSKPTKPISTTSNTTAAVKSEGVLSTEEYRPFKLIKKITLTDGPEVKCPVRLFRFELPT
GKCLGLPVGQHISLKASINGEEIARSYTPTSSNDDKGFFDVVAKIYPKGLMTQHLENMQV
GESILVSGPKGRFTYEKNKYNKLGMIAGGTGITPMLQVIEEILKHEDDKTEVSLLYGNLT
EQDIILRDRLEELASKHKNFTLFNVLNEPPAGWTQGVGFITQELIEKYLPAKGDKMNILM
CGPPPMLAAMKKVLEEKLEMKRGDHFFSF
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggtagtaaaccaaccaaaccaatcagcactaccagtaatactactgctgctgtaaag
agtgaaggtgttctctccaccgaagaatatagaccattcaaactcatcaaaaagatcact
cttaccgatggtcctgaagttaaatgcccagttcgtctctttagatttgaacttccaact
ggaaagtgcttgggtttaccagtcggtcaacacatttccttgaaggcttcaatcaatgga
gaagaaatcgctagaagctatacaccaacatcatctaatgatgataagggattcttcgat
gttgttgccaaaatttatccaaaaggattaatgacccaacatttggaaaatatgcaagtt
ggagaaagtattttggttagtggtccaaagggacgttttacatatgaaaagaacaagtat
aacaaattgggtatgattgccggtggtactggtattactccaatgttacaagttattgaa
gaaattctcaaacatgaagatgacaagactgaagttagtttattatatggtaatttgact
gaacaagatatcattttgcgtgatagactcgaggaattggcatctaaacacaagaacttt
actcttttcaatgttttgaacgaaccaccagctggttggactcaaggtgttggttttatt
actcaagaattgattgaaaagtacttgccagcaaagggtgataagatgaatattttaatg
tgtggacctccaccaatgttggctgcaatgaagaaggttttggaagaaaaattagaaatg
aaacgtggtgatcatttcttctctttttaa

DBGET integrated database retrieval system