KEGG   Naegleria gruberi: NAEGRDRAFT_82880Help
Entry
NAEGRDRAFT_82880  CDS       T01241                                 

Definition
cell division cycle protein 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ngr  Naegleria gruberi
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    NAEGRDRAFT_82880
Protein phosphatases and associated proteins [BR:ngr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     NAEGRDRAFT_82880
Ubiquitin system [BR:ngr04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     NAEGRDRAFT_82880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 734 aa AA seqDB search
METFIRHFVHQSLSFHLHENAIFLCERLFAESPSIPHLLLMAQTYFESGQYKSIFYLFSL
CCIKLEHYSDAERYLRKCHEHNENNAIINYWLGIVYKLTCRKELAIYHFHRSVTLCPMLW
TAYEQLTQLGYDKVESDGLFDSNKATSLFERFSQMYSNLTGNQPNSLTNIPLMPNFNFTP
MQNTGTEFNSNPLIDRDTIMDQPFIQLSNDHAGISSTPSKSKSGNDLISSNIINTSTAKT
PNISSTKSKTRTSIGSASRSSLGNDLLNSTSTQQTPNSFFYRTPSPQQSPSSIINHPPVL
AQKPKPPRKSQTITGVTTKKISFDSADKKLGRSSITSSSSEASPQRPYQRDSLPNQPELI
LSATTPLPSIPLDPSSVSFPSFSTWQSTFSFNYKKVTVNDVRAILSLLYAHAIPYKFFSQ
YKGKEAIEAFERLPPKHYQSGWTLQHVGRSHFEMAQYEDAETAFEKIQMNEPYRLEGLEI
YSTILWHLKKDKKLSYLAQHMSEIDKMAPQTLCAIGNCFSQQKDHETALKFFERATKVNN
LFTYAYTLAGHERAANDDLDGALQCYRHAIRIDDRHYNAWYGIGTVYFRQEKYQLAMYHF
SKAISINSKSSVLYCYAGMAEAACNHFESAIKMFTCAIKIHPQNPMPKFKKANALISLQK
YNEALEELKELKHMVPKESQIYFTCGKIYASRKQKDLALYEFNIALDLDGSKENPLIKEA
IAKLYEMDDEKLEE
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggaaacattcatcaggcattttgttcatcaatccttgtccttccatcttcatgaaaat
gcaatttttctatgtgaaagattgtttgcggaaagcccatcaatccctcacctgttattg
atggcccaaacatattttgagtcgggacaatataaaagtatcttttatttattttcttta
tgttgtattaaattggaacactacagtgatgctgaaagatatttgaggaaatgtcacgaa
cataatgaaaataacgctattattaattattggcttggaatagtctacaagttgacttgt
agaaaagagttggcaatttatcacttccatagaagtgtcactctttgtccaatgttatgg
actgcctacgaacaactaacccaactaggatatgacaaagtagaatcggatggattgttt
gattccaacaaggccacttcactttttgaaagattttctcaaatgtattctaatttaact
ggaaaccaaccaaatagtcttaccaatattcctttgatgcccaattttaattttactcca
atgcaaaacacaggcactgaatttaattctaatccacttattgatcgtgacacaattatg
gatcagccatttattcaactttcaaatgatcatgcaggaatttcatctaccccaagcaaa
tcaaaatcaggaaatgacttgataagctccaatataatcaatacatccactgctaaaaca
ccaaacatctcatcaactaaaagcaaaactagaactagtataggaagtgcttcaagaagt
agtttaggaaatgatctactcaatagcacttcaacacaacaaactccaaattcattcttc
tatagaactccttctcctcaacagtctccttcctcaattattaatcacccaccagtgtta
gctcaaaaaccaaaacctccaagaaagagccaaaccatcactggagtcacaacaaagaaa
atatcattcgactctgccgataaaaagctaggaagatcaagtattacaagctcgagtagc
gaagcatctccacaaagaccataccaaagagattctctgcctaatcaaccagaattaatt
ttgagtgcaacaacacctcttccatcaattcctttggatccaagttctgtatcattccct
tccttcagcacatggcagtcaacattttcatttaattataagaaagttactgtaaatgat
gtaagggcaatactctccctcctttatgcacatgccataccatacaaattcttttcccaa
tacaaaggaaaggaagccatagaggctttcgaaagacttcctccaaaacattatcaaagt
gggtggacgttacaacatgtgggaagatctcatttcgagatggctcaatatgaagatgca
gaaactgcattcgaaaagatacaaatgaatgagccatacagattggaaggattggaaata
tacagcaccatattgtggcacttgaaaaaagataagaagctcagttatcttgctcaacat
atgagtgaaattgataaaatggcaccacaaacattgtgtgccatcggtaactgtttcagt
caacaaaaggaccatgagacagccttaaaattcttcgaacgagctacaaaagttaataat
cttttcacctatgcctatacattagctggccatgaaagagctgcaaatgatgatttggat
ggtgcattacaatgctatagacatgcaattagaatagatgacagacattataatgcatgg
tatggtattggcacagtttactttagacaggaaaagtatcaattggctatgtatcatttc
tccaaagccatcagtattaattctaagagttcagtactctattgttatgcgggtatggca
gaagctgcctgtaatcactttgagtcagcaattaaaatgttcacttgtgccatcaagatt
catccacaaaacccaatgcccaaatttaagaaagctaatgccctcatatcactccaaaag
tataacgaagcactggaagaattgaaagaactgaagcatatggttccaaaagaatctcaa
atttactttacatgtggtaaaatttatgcctccagaaagcagaaagacctggctttgtat
gagtttaatattgctctcgatttagatggctctaaagaaaatcctctcattaaagaagct
attgcaaagctctatgagatggatgatgaaaaacttgaagaataa

DBGET integrated database retrieval system