KEGG   Naegleria gruberi: NAEGRDRAFT_83194Help
Entry
NAEGRDRAFT_83194  CDS       T01241                                 

Definition
ubiquitin hydrolase
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NAEGRDRAFT_83194
Peptidases [BR:ngr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NAEGRDRAFT_83194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 473 aa AA seqDB search
MSTTITLKWNKSTFDNVEIGDLKTGLDFKKKCQELTGVHPDRQKIMGLGAGILKDNQELS
AVKVKAGQLVRMMGSADELPEPPKEKTVFIEDTAKENGDGEVQYYPAGLENLGNTCYMNS
ALESFRYVPELREAIEHFDGSSVSELLEKDKEIASELKSLYKRLDTANDSISPITFLEAF
RKAYPQFAEKERTELGEFYSQQDSDEFITNLLGSLENMLKTSDRNVVNLITCYLYCFYRL
QCTECEEAPTVTKEAWKKLSCFISQQVSNLPYGLQKSLDGTLEKESPTLGKTAVYTKTQR
ISKLPNYLVVNFVRFFWKQKQQVKAKVLRDVAFPSVLDTFELCTDEYKNKLKETREKMRL
DREEEMKKKKEEQLNNLGQQAKKQKTEETDKTPLYQVNDSGWFELCAVVTHKGRAANEGH
YVAWVKNDAGQWLQFNDDDVTAVTEEEVKKLSGGGDWHTAYLCLYRKARKLNL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaacaattactttaaagtggaacaagtcaacttttgacaatgtcgaaattggg
gatttaaaaactggtttagatttcaagaagaaatgtcaagaattaactggtgttcatcct
gatagacaaaaaatcatgggtttgggagctggtatcttgaaagataatcaagaattgagt
gctgttaaagttaaggctggtcaacttgttagaatgatggggtctgctgatgaattacca
gaaccaccaaaggaaaaaacagtttttatcgaagatactgctaaagaaaatggtgatggt
gaagtgcaatattatccagctggtttggaaaatttaggaaatacttgttatatgaattct
gcccttgaaagctttagatacgttccagaattgagagaagctattgaacattttgatgga
tcgtctgttagtgaattgttggaaaaggataaggaaattgcctctgaattgaaatcattg
tataagagattggatactgctaatgattctatttcaccaattacatttttagaagctttc
agaaaggcttatccacaatttgctgaaaaggaacgtactgaattgggagaattttattct
caacaagactctgatgaatttattactaatttattaggatctttggaaaatatgctcaaa
actagtgatcgtaatgttgtgaatttgattacttgttacttatattgcttttacagactt
caatgtacagaatgtgaagaagctccaactgtcacaaaggaagcttggaagaaactttca
tgctttatctcacaacaagtaagcaatttaccttatggattacaaaagagtttagatggt
actttggaaaaagaatctccaactcttggtaaaactgctgtatatactaaaactcaaaga
atttccaaattgccaaattatttggttgttaactttgttcgtttcttctggaagcaaaag
caacaagttaaggctaaggttttgagagatgtcgccttcccatctgttttggatactttt
gaattgtgtactgatgaatacaagaataagttgaaggaaacaagagaaaagatgagattg
gaccgagaggaagaaatgaaaaagaagaaggaagaacaattaaataatttgggacaacaa
gccaagaagcaaaagactgaagaaactgacaagacaccactttatcaagtcaatgatagt
ggttggtttgaattgtgtgctgtagttactcacaagggtagagcagccaacgaaggtcac
tacgttgcttgggttaagaatgatgctggacaatggttgcaatttaacgatgatgatgtc
actgctgttactgaggaagaagtcaagaaattgagtggtggtggagattggcatactgct
tatttgtgtctctatcgtaaagcacgtaaactcaatttataa

DBGET integrated database retrieval system