KEGG   Naegleria gruberi: NAEGRDRAFT_83211Help
Entry
NAEGRDRAFT_83211  CDS       T01241                                 

Definition
protein kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NAEGRDRAFT_83211
Protein kinases [BR:ngr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   NAEGRDRAFT_83211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 356 aa AA seqDB search
MSEEIDKHVLRKYEIGPKLGKGAYGIVWKAVDKKTRQTVALKKIFDAFQNATDAQRTYRE
IMLLQNLHHDNIVRLLNVLKADNDNDIYLIFEFMDTDLHAVIRANILEEIHKQYNIYQLL
KTLKYIHSANLLHRDIKPSNLLLNSECHMKLADFGLARSVTQVDKDHGPVLTDYVATRWY
RAPEILLGSTKYTKGVDLWSVGCILGELICGKPMFPGTSTMNQLQRIIAVTGPPSAEDID
AIQSAFASSMLDSIPETEQKSLQEMFPKASPEALDLLSKLLQFNPEKRIDAETALKHPYV
ALFHNPAEEPTCDKPISLFFDDNKKYSINEYRERLYAEIRKRREKRRARTKEDEKK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaaattgataaacacgttctcagaaagtacgaaattggaccaaagttaggt
aaaggagcctacggtattgtgtggaaggctgttgataaaaagactagacaaactgttgct
ttgaagaaaatctttgatgctttccaaaatgctaccgatgcccaacgtacctatcgtgaa
atcatgcttcttcaaaatttgcaccatgacaatattgtccgtttgttgaacgtactcaaa
gctgataatgacaatgacatttacttgattttcgaatttatggatactgacttgcatgct
gttattagagccaatattttggaagaaattcacaaacaatacaacatttatcaattgttg
aagacattgaaatatatccatagtgccaatttgctccacagagacatcaagccttcaaac
ttgcttttgaattctgaatgtcatatgaaattggctgactttggtctggcgaggagtgtt
acccaagttgataaggatcacggacctgttttgactgactatgttgcaactcgttggtat
cgtgctcctgaaattttgttgggttcaacaaagtataccaagggtgttgatctttggtct
gttggttgtatattaggtgaattaatctgtggtaaaccaatgttccctggaacatcaaca
atgaatcaattgcaaagaattattgctgtgacaggtccaccaagcgcagaagatattgat
gctattcaatctgcttttgcttcatctatgcttgattctattccagaaactgaacaaaag
tctttacaagaaatgttcccaaaggcatctccagaagctttggatttattatcaaaatta
ttacaattcaatcctgaaaagagaattgacgctgaaactgctctcaaacatccatatgtt
gctcttttccacaatcctgctgaagagccaacttgtgacaagccaatttctctcttcttc
gatgataacaagaagtactccataaatgaatatcgtgaaagactctatgctgaaattaga
aagagaagagaaaagagacgtgctaggactaaggaagatgaaaagaaataa

DBGET integrated database retrieval system