KEGG   Naegleria gruberi: NAEGRDRAFT_83226Help
Entry
NAEGRDRAFT_83226  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
ngr  Naegleria gruberi
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ngr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 367 aa AA seqDB search
MWGQPSMGQPSTGFQMGQMQGNPQMGDVNPNGSYCLPDLPSDTVSMISWCPTQNFIVASS
WDGSVTAWEIQAAQNMGKVQVMASAKARYKHEAPALCCCMSRDGKIFSAGCDNKAKYQQL
GQQADVTFGQHDQPIKIIKSLDGVEGMQTIVMTGSWDKSIKYWDIRNNNGQAVMSLPQAD
KIYDVSVAGNMAVVALANKEVYIYDVRKPQEPFKKYPSPLREQTRCVACFPDMSGFAIGS
IEGRVGINYFQETTTRKNFAFKCHRDGPNTANVYAVNALSFHPSFGSFSTAGADGTFHFW
DHTSKQRLHQFKKLGADLTLLSTGFNGDGSLFAYAVGYDWSKGHEHYNKHTYIYIHVCEE
PQVKPKK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtggggacaaccaagtatgggacaaccttctacagggtttcaaatgggacaaatgcaa
ggaaatccacaaatgggagatgttaatccgaatggaagttattgtttacctgatcttcct
tctgatacagtttccatgatttcatggtgtcctactcagaattttattgttgctagttct
tgggatggatcagtcacagcctgggaaattcaagcagcacaaaatatgggaaaggtacaa
gttatggcatcagctaaggcaagatataaacatgaagctcctgctctctgttgttgtatg
tctagggatggtaaaatattctctgcaggttgtgataacaaggctaaatatcaacaatta
ggacaacaagcggatgtaacttttggacaacacgatcaacctattaaaataattaaatca
ttagatggagtggaaggaatgcaaactatagtaatgacaggaagttgggataaatcaatt
aaatactgggatattagaaataataatggacaagccgtaatgtctctaccacaagctgat
aagatttatgacgtatctgtggcaggaaatatggctgtagtagctttggctaataaggaa
gtttacatttatgatgtcagaaaaccacaagaaccatttaaaaagtacccatcaccactc
agagaacaaaccagatgtgttgcttgtttccctgacatgtcaggatttgcaattggatct
attgaaggacgtgtcggtatcaattatttccaagaaacaactacaaggaagaattttgct
ttcaagtgtcacagagatggcccaaatactgccaatgtatatgcagtcaatgctctctca
ttccatccaagttttggatcattttctactgctggtgctgatggtactttccacttttgg
gatcacacctcaaaacaaagattacaccaattcaaaaaattgggtgccgacttgacactg
ctttcaacaggtttcaatggagatggttccttatttgcctatgctgttggttacgattgg
agtaagggtcacgaacattacaataagcatacttatatttacattcatgtgtgtgaagaa
cctcaagttaaaccaaagaaataa

DBGET integrated database retrieval system