KEGG   Neisseria gonorrhoeae TCDC-NG08107: NGTW08_0002Help
Entry
NGTW08_0002       CDS       T01927                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ngt  Neisseria gonorrhoeae TCDC-NG08107
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ngt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NGTW08_0002 (tpiA)
   01230 Biosynthesis of amino acids
    NGTW08_0002 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGTW08_0002 (tpiA)
   00051 Fructose and mannose metabolism
    NGTW08_0002 (tpiA)
   00562 Inositol phosphate metabolism
    NGTW08_0002 (tpiA)
Enzymes [BR:ngt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NGTW08_0002 (tpiA)
Exosome [BR:ngt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NGTW08_0002 (tpiA)
  Exosomal proteins of bladder cancer cells
   NGTW08_0002 (tpiA)
  Exosomal proteins of melanoma cells
   NGTW08_0002 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(874..1629)
Genome map
AA seq 251 aa AA seqDB search
MWDQKWVIGNWKMNGRLQNNNALMHRFRILPTAERVLIGLAAPTVYLLQLHNAMQIVLNN
RILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIGHSERSLYFGEKNEIQRRKMENV
LNVGLIPLLCVGESLEERETGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGTGKVATV
EQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGASLSYDS
FTAIISAAQNA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtgggatcaaaaatgggtcatcggcaactggaaaatgaacggccggctccaaaacaac
aacgcactgatgcaccgcttccgcatcctccccaccgccgaacgcgtcctcatcggactc
gccgccccgaccgtttacctgctgcaactgcacaacgccatgcaaatcgtcttaaacaac
cgcatcctcacctgcgcccaagacgtgagccgcttccccgacaacggcgcgtacaccggc
gaagtgtccgccgaaatgctcgccgacaccggcacagacatcgtcctcatcggacactcc
gaacgcagcctttatttcggcgaaaaaaacgaaatccaacgccgcaaaatggaaaacgtc
ctcaacgtcggactcatcccattattgtgcgtcggcgaaagcctcgaagagcgcgaaacc
ggcaaagaacacgaagtcatcgcccatcagctttccatcctgcaagggctggataccaaa
aacatcgccgtcgcctacgaacccgtctgggcaatcggcacaggcaaagtcgccaccgtc
gaacagattgccgatatgcacgcattcatctacaaagaaatcttgtctttgtgcggaagc
gatgttaaaatccgcgtcctttacggcggaagtgtgaaagcggacaacgcggccgacatc
ttcgcagtaccttatgtggacggcgcactcgtcggcggcgcgtcattgtcgtacgactcc
tttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system